DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33654 and CG12849

Sequence 1:NP_001027165.1 Gene:CG33654 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_611969.2 Gene:CG12849 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster

Alignment Length:169 Identity:64/170 (38%)
Similarity:101/170 (59%) Gaps:17/170 (10%)


  Fly    13 LVILLMAKWASSKFEFTNLQCTSFDKSFDDFEYCYIRSANRSYKYLTLKVNLFKTP--------- 68
            |:|.:........|||.|:.|...|:.|.||||||::|.||:||||:||..:|:.|         
  Fly     8 LLIFMSPMAIRGHFEFNNVVCLVRDRMFMDFEYCYLKSVNRTYKYLSLKTKMFRLPVDNCETRFQ 72

  Fly    69 ---RFNGYRPFMFNITLDACRFLKNTDSK-PIAKYFYEFFNSYSNLNHSCPFNHDLIVDKIPIDF 129
               |.|....:.|:..:|:|:|::  |.| .||.:.|:.|..||||||:||::||:::||:|:..
  Fly    73 LRMRENRRVLYNFDFKVDSCKFMR--DRKHVIANWVYQTFGPYSNLNHTCPYDHDIVLDKLPVQH 135

  Fly   130 VNHRVTNILPFPEGDYLLETHWIAYEIDRAMVKIYYTIS 168
            :|..|.:|:  |:|.|::.:.|:...|.|..|.:|:|.|
  Fly   136 LNKLVQSII--PDGRYMMNSTWMVAGIPRTDVILYFTKS 172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 35/100 (35%)
CG12849NP_611969.2 DM8 80..172 CDD:214778 35/96 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C288042
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.