DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33654 and CG33923

Sequence 1:NP_001027165.1 Gene:CG33654 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001027216.2 Gene:CG33923 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster

Alignment Length:172 Identity:84/173 (49%)
Similarity:120/173 (69%) Gaps:12/173 (7%)


  Fly     9 IVVILVILLMAKWASSKFEFTNLQCTSFDKSFDDFEYCYIRSANRSYKYLTLKVNLFKTP----- 68
            :|.:.:.|.....|..|.||.|::|.:.|..|.||:|||:::.:|:||||:|:|.|.:||     
  Fly     7 LVQLSIFLYSFHQAVCKVEFANIKCVTLDPEFADFDYCYLKAVSRTYKYLSLRVKLLETPITKIK 71

  Fly    69 -------RFNGYRPFMFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFNHDLIVDKIP 126
                   |.|||:||::|:|:|||:|.||..|.|||:|.|.||..|||:|||||::||:||:|:|
  Fly    72 INVAILQRLNGYKPFLYNVTIDACKFYKNQKSNPIARYLYSFFKDYSNINHSCPYDHDIIVEKLP 136

  Fly   127 IDFVNHRVTNILPFPEGDYLLETHWIAYEIDRAMVKIYYTIS 168
            |..||.:||.:||.|.||||..::|.||:|:||:|.:|.|||
  Fly   137 ISHVNTQVTKVLPVPHGDYLFHSNWYAYDINRAIVDVYATIS 178

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 53/99 (54%)
CG33923NP_001027216.2 DUF1091 72..157 CDD:284008 48/85 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C287145
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.