DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33654 and CG33644

Sequence 1:NP_001027165.1 Gene:CG33654 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001027259.1 Gene:CG33644 FlyBaseID:FBgn0053644 Length:158 Species:Drosophila melanogaster

Alignment Length:115 Identity:27/116 (23%)
Similarity:43/116 (37%) Gaps:15/116 (13%)


  Fly    29 TNLQCTSFDKSFDDFEYCYI--RSANRSYKYLTLKVNLFKTPR-FNGYRPFMF-------NIT-- 81
            |.::|......:.....|.:  :|.|...|..:.:.:|.|... ..|...|.|       |.|  
  Fly     6 TQIECPIHSPEYVQNFSCRLHKKSPNSGSKSFSAEFSLRKEVNDVRGAYVFSFKQGKSIINYTAM 70

  Fly    82 -LDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPF--NHDLIVDKIPID 128
             :|.|:.|....|:.:.|...:.....||...:|||  |....||:..|:
  Fly    71 EIDYCQALSALQSQILFKLIADELRRVSNFPLNCPFVMNKRYYVDEFTIN 120

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 21/83 (25%)
CG33644NP_001027259.1 DUF1091 50..133 CDD:284008 19/72 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.