DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33654 and CG33679

Sequence 1:NP_001027165.1 Gene:CG33654 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001027273.1 Gene:CG33679 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster

Alignment Length:169 Identity:53/170 (31%)
Similarity:79/170 (46%) Gaps:35/170 (21%)


  Fly    21 WASSKF--------EFTNLQCTSFDKSFDDFEYCYIRSANRSYKYLTLKVNLFKTP--------- 68
            |.|..|        ..|||:|.|:||||..|..|.::...|......:.|.|.|.|         
  Fly     6 WISLLFIGESHGYVRLTNLKCESYDKSFVVFPECRLKVLGRGIIGANIHVKLLKLPINRMVVRFI 70

  Fly    69 ---RFNGYRPFMFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFNHDLIVDKIPIDFV 130
               :.|||.||:||::.:.||.|:..:...:..|||..|..:||:||:||:|.|:.:....:|  
  Fly    71 TYRKLNGYHPFLFNVSEEHCRVLRYPNRLRVFYYFYTAFMPFSNINHTCPYNDDIYIRNCTLD-- 133

  Fly   131 NHRVTNILPFPEGDYLLE-------THWIA-----YEID 157
             .|:...:|.|:|.|.|.       .:||:     :|||
  Fly   134 -DRMFAKVPLPKGSYKLTLEMDDGVVNWISIINIHFEID 171

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 32/99 (32%)
CG33679NP_001027273.1 DUF1091 70..149 CDD:284008 28/82 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C298765
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.