DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33654 and CG33773

Sequence 1:NP_001027165.1 Gene:CG33654 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001027213.1 Gene:CG33773 FlyBaseID:FBgn0053773 Length:179 Species:Drosophila melanogaster

Alignment Length:175 Identity:81/176 (46%)
Similarity:118/176 (67%) Gaps:12/176 (7%)


  Fly     6 RCHIVVILVILLMAKWASSKFEFTNLQCTSFDKSFDDFEYCYIRSANRSYKYLT----------- 59
            |.::::.::|.......:|:||||||.||:||....:||.|.::|.||||||::           
  Fly     5 RINLILAILIFYSIIKTNSRFEFTNLNCTAFDLRVGEFENCNLKSINRSYKYVSGKYKLNQIPLP 69

  Fly    60 -LKVNLFKTPRFNGYRPFMFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFNHDLIVD 123
             :|||.....|.||||||::|||.|||:|::|..|.|:.||.::.|::|||:|||||:..||||:
  Fly    70 RMKVNFIMWKRLNGYRPFLYNITADACKFVENPKSNPVLKYIFDSFSAYSNMNHSCPYTSDLIVE 134

  Fly   124 KIPIDFVNHRVTNILPFPEGDYLLETHWIAYEIDRAMVKIYYTIS 168
            ::||.|:|.|||.|||||||:||.|.|:...:...|..::|:|||
  Fly   135 RLPIGFMNLRVTEILPFPEGNYLFEFHFSRRKSIFASTQVYFTIS 179

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 51/87 (59%)
CG33773NP_001027213.1 DUF1091 73..158 CDD:284008 50/85 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C286113
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.