DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33654 and CG33777

Sequence 1:NP_001027165.1 Gene:CG33654 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001027108.1 Gene:CG33777 FlyBaseID:FBgn0053777 Length:172 Species:Drosophila melanogaster

Alignment Length:172 Identity:77/173 (45%)
Similarity:115/173 (66%) Gaps:18/173 (10%)


  Fly     8 HIVVILVILLMAKWASSKFEFTNLQCTSFDKSFDDFEYCYIRSANRSYKYLTLKVNLFKTP---- 68
            :::.:|..|.:.:      :|||::|||.|..|...::||::|.||:||||:|:|||.:.|    
  Fly     6 YLIQLLFFLFLVE------KFTNIKCTSLDPEFAHVDHCYLKSVNRTYKYLSLRVNLLQKPVSRI 64

  Fly    69 --------RFNGYRPFMFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFNHDLIVDKI 125
                    |:|||:|.::|.|:|||:|:||..|.|:|.|.|..|..|||:|::||||.|.||:|:
  Fly    65 KVNAATWKRYNGYKPSLYNFTVDACKFIKNPKSNPVAHYIYRLFKDYSNVNYTCPFNDDAIVEKL 129

  Fly   126 PIDFVNHRVTNILPFPEGDYLLETHWIAYEIDRAMVKIYYTI 167
            ||.|||::||::||.|.||||..:||..|:|.|..:.:|.||
  Fly   130 PISFVNNQVTSVLPVPSGDYLFSSHWYFYDIKRVTINVYMTI 171

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 50/99 (51%)
CG33777NP_001027108.1 DUF1091 72..151 CDD:284008 45/79 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C287125
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.