DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33654 and CG33770

Sequence 1:NP_001027165.1 Gene:CG33654 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001027144.2 Gene:CG33770 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster

Alignment Length:165 Identity:39/166 (23%)
Similarity:65/166 (39%) Gaps:36/166 (22%)


  Fly     6 RCHIVVILVILLMAKWASSKFEFTNLQCTSFDKSFDDFEYCYIRSANRSYKYLTLKVNL------ 64
            |..|.:.|.|.|.:..|....:|...:.....|.|::|.:. ||: ::.:..:.|:..|      
  Fly    12 RLEIPLCLAIALFSIRAEGSVKFIAGESRFNRKYFENFTFT-IRN-DKIFLDMYLRKPLVRGWRA 74

  Fly    65 ---FKTPRFNGYRPF--MFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFN--HDLIV 122
               |:| |....:.|  :|:.::|.|..: |.....:.|.:|:....|.|....||.|  |..:.
  Fly    75 RLDFRT-RVGNSKSFQSLFSTSIDVCNIV-NAAKINLFKKWYKNLLKYGNFLRQCPLNASHYYLR 137

  Fly   123 D------KIPIDFVNHRVTNILPF-PEGDYLLETH 150
            |      .:|            || ..|.|.|||:
  Fly   138 DWQFGEGLVP------------PFITSGSYRLETY 160

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 24/107 (22%)
CG33770NP_001027144.2 DM8 88..178 CDD:214778 22/87 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49621
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.