DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33654 and CG33752

Sequence 1:NP_001027165.1 Gene:CG33654 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001027409.1 Gene:CG33752 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster

Alignment Length:161 Identity:51/162 (31%)
Similarity:80/162 (49%) Gaps:28/162 (17%)


  Fly    29 TNLQCTSFDKSFDDFEYCYIRSANRS-------YKYLTL-----KVNLFKTPRFNGYRPFMFNIT 81
            ||::|...||||.:|..|.:....|.       .|:|.|     .||.....:.:||.||:||:|
  Fly    27 TNVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYMKFLKLPIKKISVNFTVYKKLSGYHPFLFNVT 91

  Fly    82 LDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFN-----HDLIVDKIPIDFVNHRVTNI---- 137
            :|.|.::|:.:...|..|||.....|||.|||||:|     ||::|.    |||   :|:.    
  Fly    92 VDFCHYMKHPNPMNIFHYFYTAVKPYSNFNHSCPYNVSESYHDILVK----DFV---LTDTMFAK 149

  Fly   138 LPFPEGDYLLETHWIAYEIDRAMVKIYYTIS 168
            :|.|.|:|:........::.|.::..|:.::
  Fly   150 IPLPTGNYMFSIKLATDDVWRVVLNTYFDVN 180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 37/101 (37%)
CG33752NP_001027409.1 DUF1091 72..159 CDD:284008 36/94 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C298655
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.