DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33654 and CG33752

DIOPT Version :10

Sequence 1:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster


Alignment Length:161 Identity:51/161 - (31%)
Similarity:80/161 - (49%) Gaps:28/161 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 TNLQCTSFDKSFDDFEYCYIRSANRS-------YKYLTL-----KVNLFKTPRFNGYRPFMFNIT 81
            ||::|...||||.:|..|.:....|.       .|:|.|     .||.....:.:||.||:||:|
  Fly    27 TNVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYMKFLKLPIKKISVNFTVYKKLSGYHPFLFNVT 91

  Fly    82 LDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFN-----HDLIVDKIPIDFVNHRVTNI---- 137
            :|.|.::|:.:...|..|||.....|||.|||||:|     ||::|.    |||   :|:.    
  Fly    92 VDFCHYMKHPNPMNIFHYFYTAVKPYSNFNHSCPYNVSESYHDILVK----DFV---LTDTMFAK 149

  Fly   138 LPFPEGDYLLETHWIAYEIDRAMVKIYYTIS 168
            :|.|.|:|:........::.|.::..|:.::
  Fly   150 IPLPTGNYMFSIKLATDDVWRVVLNTYFDVN 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:461928 37/100 (37%)
CG33752NP_001027409.1 DUF1091 72..159 CDD:461928 36/93 (39%)

Return to query results.
Submit another query.