DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33654 and CG33642

Sequence 1:NP_001027165.1 Gene:CG33654 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001027257.1 Gene:CG33642 FlyBaseID:FBgn0053642 Length:187 Species:Drosophila melanogaster

Alignment Length:175 Identity:40/176 (23%)
Similarity:68/176 (39%) Gaps:53/176 (30%)


  Fly    28 FTN---LQC--TSFDKSFDDFEYCY-------------IRSANRSYK-------------YLTLK 61
            |||   |:|  .||....::|...|             :...||||.             .:...
  Fly    15 FTNHICLKCEERSFRIKMNEFAVKYKMRDLIQHIDFRIVNLNNRSYVNGEMIVKSDVEDILMHTT 79

  Fly    62 VNLFKTPRFNGYRPFMFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFNHDLIVDKIP 126
            ::.:||.  |..:..:::..||||:|||.:....:.|.:.:.|..:.:.|.|||...:.      
  Fly    80 MDFWKTS--NQKKIKLYDGRLDACQFLKTSHRNGLFKIYVKSFKKHIHGNLSCPLRTNF------ 136

  Fly   127 IDFVNHRVTN-------ILPF-PEGDYLLETHWIAYEIDRAMVKI 163
                |:.:||       :.|| |.|.:...|.:  :..||..::|
  Fly   137 ----NYTLTNWHMDEKDLPPFVPLGTFRTVTEY--FTQDRLALRI 175

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 23/95 (24%)
CG33642NP_001027257.1 DUF1091 79..160 CDD:284008 23/93 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.