DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33654 and CG14492

Sequence 1:NP_001027165.1 Gene:CG33654 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_611275.2 Gene:CG14492 FlyBaseID:FBgn0034283 Length:199 Species:Drosophila melanogaster

Alignment Length:136 Identity:32/137 (23%)
Similarity:52/137 (38%) Gaps:39/137 (28%)


  Fly    11 VILVILLMAKW-----ASSKFEFTNLQCTSFDKSFDDFEYCYIR----SANRSYKYLT------- 59
            :::.:.|:..|     |.:.||   ||..:|..|.||.....::    ..::|.|..|       
  Fly    12 MVIFLYLLPNWKLEAEAKNNFE---LQTDNFTCSSDDISSSVLKEFTCGISKSTKRRTWHMEFVL 73

  Fly    60 ----------LKVNLFKTPRFNGYRPF----MFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNL 110
                      :|:.|   ||   .||.    :.|:|.|.|:.|.|.:..|:.:........:||.
  Fly    74 EQPVAEHDFFIKIVL---PR---RRPLPDFVLLNVTTDGCQLLANRNQVPLMRLGRNIMERFSNF 132

  Fly   111 NHSCPF 116
            ...|||
  Fly   133 PKQCPF 138

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 18/62 (29%)
CG14492NP_611275.2 DM8 95..186 CDD:214778 12/45 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.