DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33654 and CG33137

Sequence 1:NP_001027165.1 Gene:CG33654 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_788343.3 Gene:CG33137 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster

Alignment Length:134 Identity:27/135 (20%)
Similarity:54/135 (40%) Gaps:25/135 (19%)


  Fly    26 FEFTNLQCTSFDKSFDDFEYCYIRSAN-------------RSYKYLTLKVNLFKTPRFNGYRPFM 77
            ::..|::|::. ..|.....|:||:.|             |....:|::..:.|....|.::||:
  Fly    14 YKLKNIECSTV-PGFSANASCHIRAINWNKAVAEMDVYLLRPLYNITIRFQILKKDYSNKFQPFL 77

  Fly    78 FNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPF-----------NHDLIVDKIPIDFVN 131
            .::.::.|..|......|......:...::||.|||||:           |...:.:..|:.|..
  Fly    78 VDVVINMCDALSRRSFIPYGLIILKIARTFSNFNHSCPYRGHLMARGAYLNESYLPNVFPLGFYK 142

  Fly   132 HRVT 135
            ..:|
  Fly   143 FNIT 146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 18/88 (20%)
CG33137NP_788343.3 DM8 73..164 CDD:214778 16/75 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C298745
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.