DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33654 and CG33137

DIOPT Version :10

Sequence 1:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster


Alignment Length:134 Identity:27/134 - (20%)
Similarity:54/134 - (40%) Gaps:25/134 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 FEFTNLQCTSFDKSFDDFEYCYIRSAN-------------RSYKYLTLKVNLFKTPRFNGYRPFM 77
            ::..|::|::. ..|.....|:||:.|             |....:|::..:.|....|.::||:
  Fly    14 YKLKNIECSTV-PGFSANASCHIRAINWNKAVAEMDVYLLRPLYNITIRFQILKKDYSNKFQPFL 77

  Fly    78 FNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPF-----------NHDLIVDKIPIDFVN 131
            .::.::.|..|......|......:...::||.|||||:           |...:.:..|:.|..
  Fly    78 VDVVINMCDALSRRSFIPYGLIILKIARTFSNFNHSCPYRGHLMARGAYLNESYLPNVFPLGFYK 142

  Fly   132 HRVT 135
            ..:|
  Fly   143 FNIT 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:461928 18/87 (21%)
CG33137NP_788343.3 DM8 73..164 CDD:214778 16/74 (22%)

Return to query results.
Submit another query.