DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33654 and CG13193

Sequence 1:NP_001027165.1 Gene:CG33654 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_610699.1 Gene:CG13193 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster

Alignment Length:173 Identity:38/174 (22%)
Similarity:61/174 (35%) Gaps:42/174 (24%)


  Fly     3 KNTRCH---IVVILVILLMAKWASSKFEFTNLQCTSFDKSFDDFEYC-YIRSANRSYKYLTLKVN 63
            |:.:.|   |.:.:..|.......|||...:::|:.        :|| .||....:...|.|.::
  Fly    11 KSPQAHQDLIQIQISALRFGPTLRSKFTNISVECSK--------DYCSSIRGWLTAKGELNLDIH 67

  Fly    64 LFKTPRFNGYR---------------PFMFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHS 113
            |.:|.: ||.|               ..:|:..:|.|:.|:......:.|.:......|.||...
  Fly    68 LNRTLK-NGLRTTITLLQLIDGKDRYQTLFSYDMDTCKTLRELLQSSLMKVWLRNVFKYGNLADR 131

  Fly   114 CPF-------------NHDLIVDKIPIDFVNHRVTNILPFPEG 143
            ||.             ||. |...:|..|.....||....|:|
  Fly   132 CPIQPASYDVRNFQLENHS-IPGYLPAGFYRLHDTNYYGKPKG 173

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 25/113 (22%)
CG13193NP_610699.1 DM8 91..183 CDD:214778 19/85 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49854
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.