DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33654 and CG33463

DIOPT Version :10

Sequence 1:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_995846.2 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:180 Species:Drosophila melanogaster


Alignment Length:172 Identity:77/172 - (44%)
Similarity:115/172 - (66%) Gaps:16/172 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ILVILLMAKWASSK----FEFTNLQCTSFDKSFDDFEYCYIRSANRSYKYLTLKVNLFKTP---- 68
            :|:.|.:|...:||    .||.|:.|.:.||.|.:|||||::|.||:|||:::|:.|.:.|    
  Fly     7 LLLTLWLAMQLASKTTAMLEFKNINCEAVDKEFSEFEYCYLKSVNRTYKYISVKLKLLQLPVTNA 71

  Fly    69 --------RFNGYRPFMFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFNHDLIVDKI 125
                    |.|||:||::|||:|.|:.:||....|:|.||::.|..:||:|||||||||:|:||:
  Fly    72 KVNGALFQRHNGYKPFLYNITVDCCKLVKNPKYSPVASYFFDTFKEFSNMNHSCPFNHDIILDKL 136

  Fly   126 PIDFVNHRVTNILPFPEGDYLLETHWIAYEIDRAMVKIYYTI 167
            ....|.||:|||||||||||:|:.:|....|.|.:.|::.::
  Fly   137 TAKSVYHRMTNILPFPEGDYMLQLNWFTSGIYRVIFKVFVSL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:461928 49/98 (50%)
CG33463NP_995846.2 DUF1091 73..158 CDD:461928 46/84 (55%)

Return to query results.
Submit another query.