powered by:
                   
 
    
    
             
          
            Protein Alignment CG33654 and CG33463
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_001027165.1 | Gene: | CG33654 / 3771825 | FlyBaseID: | FBgn0053654 | Length: | 168 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_995846.2 | Gene: | CG33463 / 2768844 | FlyBaseID: | FBgn0053463 | Length: | 180 | Species: | Drosophila melanogaster | 
        
        
        
          
            | Alignment Length: | 172 | Identity: | 77/172 - (44%) | 
          
            | Similarity: | 115/172 -  (66%) | Gaps: | 16/172 - (9%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly    12 ILVILLMAKWASSK----FEFTNLQCTSFDKSFDDFEYCYIRSANRSYKYLTLKVNLFKTP---- 68:|:.|.:|...:||    .||.|:.|.:.||.|.:|||||::|.||:|||:::|:.|.:.|
 Fly     7 LLLTLWLAMQLASKTTAMLEFKNINCEAVDKEFSEFEYCYLKSVNRTYKYISVKLKLLQLPVTNA 71
 
 
  Fly    69 --------RFNGYRPFMFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFNHDLIVDKI 125|.|||:||::|||:|.|:.:||....|:|.||::.|..:||:|||||||||:|:||:
 Fly    72 KVNGALFQRHNGYKPFLYNITVDCCKLVKNPKYSPVASYFFDTFKEFSNMNHSCPFNHDIILDKL 136
 
 
  Fly   126 PIDFVNHRVTNILPFPEGDYLLETHWIAYEIDRAMVKIYYTI 167....|.||:|||||||||||:|:.:|....|.|.:.|::.::
 Fly   137 TAKSVYHRMTNILPFPEGDYMLQLNWFTSGIYRVIFKVFVSL 178
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 1 | 0.930 | - | - |  | C45472016 | 
          
            | Domainoid | 1 | 1.000 | 52 | 1.000 | Domainoid score | I18610 | 
          
            | eggNOG | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 1 | 1.050 | 72 | 1.000 | Inparanoid score | I7527 | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 1 | 1.000 | - | - |  | FOG0000262 | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 1 | 1.100 | - | - | P | PTHR20898 | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 1 | 1.000 | - | - |  | X90 | 
          
            |  | 7 | 6.990 |  | 
        
      
           
             Return to query results.
             Submit another query.