DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33654 and CG33463

Sequence 1:NP_001027165.1 Gene:CG33654 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_995846.1 Gene:CG33463 FlyBaseID:FBgn0053463 Length:157 Species:Drosophila melanogaster

Alignment Length:153 Identity:72/154 (47%)
Similarity:106/154 (69%) Gaps:12/154 (8%)


  Fly    27 EFTNLQCTSFDKSFDDFEYCYIRSANRSYKYLTLKVNLFKTP------------RFNGYRPFMFN 79
            ||.|:.|.:.||.|.:|||||::|.||:|||:::|:.|.:.|            |.|||:||::|
  Fly     3 EFKNINCEAVDKEFSEFEYCYLKSVNRTYKYISVKLKLLQLPVTNAKVNGALFQRHNGYKPFLYN 67

  Fly    80 ITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFNHDLIVDKIPIDFVNHRVTNILPFPEGD 144
            ||:|.|:.:||....|:|.||::.|..:||:|||||||||:|:||:....|.||:||||||||||
  Fly    68 ITVDCCKLVKNPKYSPVASYFFDTFKEFSNMNHSCPFNHDIILDKLTAKSVYHRMTNILPFPEGD 132

  Fly   145 YLLETHWIAYEIDRAMVKIYYTI 167
            |:|:.:|....|.|.:.|::.::
  Fly   133 YMLQLNWFTSGIYRVIFKVFVSL 155

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 49/99 (49%)
CG33463NP_995846.1 DUF1091 50..135 CDD:284008 46/85 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C286285
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.