DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33654 and CG33483

DIOPT Version :10

Sequence 1:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster


Alignment Length:158 Identity:82/158 - (51%)
Similarity:115/158 - (72%) Gaps:12/158 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SSKFEFTNLQCTSFDKSFDDFEYCYIRSANRSYKYLTLKVNLFKTP------------RFNGYRP 75
            :|..||||::|||:||:|||||||:::|.|||:|||:|||||.|.|            |||||:|
  Fly    72 ASLVEFTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVNLHKVPITKVKVNFSLLKRFNGYKP 136

  Fly    76 FMFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFNHDLIVDKIPIDFVNHRVTNILPF 140
            |::|||:|||:.|:::...||..:||..|..:||:||:|||:|||||:|:|.:|:|.:|...:.|
  Fly   137 FLYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFDHDLIVEKLPTNFMNQKVNGDIKF 201

  Fly   141 PEGDYLLETHWIAYEIDRAMVKIYYTIS 168
            |.||||..:.|.||.|:||.|..:.|:|
  Fly   202 PHGDYLFHSDWYAYGINRATVDFFLTLS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:461928 48/98 (49%)
CG33483NP_001189327.1 DUF1091 123..208 CDD:461928 41/84 (49%)

Return to query results.
Submit another query.