DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33654 and CG33483

DIOPT Version :9

Sequence 1:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster


Alignment Length:158 Identity:82/158 - (51%)
Similarity:115/158 - (72%) Gaps:12/158 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SSKFEFTNLQCTSFDKSFDDFEYCYIRSANRSYKYLTLKVNLFKTP------------RFNGYRP 75
            :|..||||::|||:||:|||||||:::|.|||:|||:|||||.|.|            |||||:|
  Fly    72 ASLVEFTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVNLHKVPITKVKVNFSLLKRFNGYKP 136

  Fly    76 FMFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFNHDLIVDKIPIDFVNHRVTNILPF 140
            |::|||:|||:.|:::...||..:||..|..:||:||:|||:|||||:|:|.:|:|.:|...:.|
  Fly   137 FLYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFDHDLIVEKLPTNFMNQKVNGDIKF 201

  Fly   141 PEGDYLLETHWIAYEIDRAMVKIYYTIS 168
            |.||||..:.|.||.|:||.|..:.|:|
  Fly   202 PHGDYLFHSDWYAYGINRATVDFFLTLS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 48/98 (49%)
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 41/84 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472097
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.