DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33689 and CG34303

Sequence 1:NP_001027132.2 Gene:CG33689 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001356898.1 Gene:CG34303 FlyBaseID:FBgn0085332 Length:181 Species:Drosophila melanogaster

Alignment Length:174 Identity:50/175 (29%)
Similarity:84/175 (48%) Gaps:12/175 (7%)


  Fly     5 FNVFIIMGSLMAIHTHMTFTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPIDNITI 69
            ||:|:|    ..:|....|.::.|....|.....|.|.|||::|.|..:::...|.| .|..:.|
  Fly    14 FNIFVI----SKVHGSYKFNSLACEVMAPELGKMKLCEIKAIDRKHNMINLSAFLNK-TISEVEI 73

  Fly    70 SFRLMRHDH-GYKPFFIDYTFDGCKFLRNQKHPII-KLFYKIYQGSSNINHTCPYDHDIIVDHLW 132
            .|::::.:. |:.|||.|...|.|:|.:|::...| .|.|...:..:|:||||||.....: .||
  Fly    74 HFKMVKRERGGWHPFFYDIRIDVCQFFKNRRGFFISNLIYSFIKPYTNVNHTCPYMEGTEM-RLW 137

  Fly   133 TGNIESD-FLKYIPMINGDYAVYSNWSTDNIMRAYLN---LYFR 172
            ..:.:.| .|...|:.:|.|.:.:.|.........:|   ::||
  Fly   138 NWSPDEDAVLAKFPVDHGTYGLQTTWYVKKEAALKVNGSVIFFR 181

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 26/83 (31%)
CG34303NP_001356898.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.