DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33689 and CG14456

DIOPT Version :10

Sequence 1:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster


Alignment Length:111 Identity:25/111 - (22%)
Similarity:45/111 - (40%) Gaps:5/111 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GSLMAIHTHMTFTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPIDNITISFRLMRH 76
            |||........|.:||..| |..|...|..:..:....:..::|:..|:.:   :|.:..|:...
  Fly    18 GSLAEKMMRPKFKDIKFWS-DEKFVSHKVVYDNSDPHLNFSMEVHQELHDV---DIHVEVRITNK 78

  Fly    77 DHGYKPFFIDYTFDGCKFLR-NQKHPIIKLFYKIYQGSSNINHTCP 121
            ...|....::.|.:.|:.|. ..|.|:.:..:...:...||..|||
  Fly    79 QDPYYNTNLNTTLNVCRILGFANKSPVGRFVHGFIREFGNIVETCP 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:461928 11/50 (22%)
CG14456NP_001137998.1 DM8 82..189 CDD:214778 11/43 (26%)

Return to query results.
Submit another query.