DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33689 and CG14455

DIOPT Version :10

Sequence 1:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster


Alignment Length:130 Identity:27/130 - (20%)
Similarity:50/130 - (38%) Gaps:43/130 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KYVDVYVNLY------KLPID----------NITISFRLMRHDHGYKPFFIDYTFDGCKFLRNQ- 98
            |::|:.|:|.      .|.||          .:.:.|.| ..|.|.....|:.|.:.||.::.: 
  Fly    43 KFLDLKVDLQNDSGESNLSIDIKTHQDIEDVQLVVDFGL-ETDKGNYSTLINRTLNFCKLMKQRN 106

  Fly    99 KHPIIKLFYKIYQGSSNINHTCPYDHDIIVDHLWTGNIESDFLKYIPMINGDYAVYSNWSTDNIM 163
            ..|:::..|:                    |.|..|.:    .|..|:.:|.|:: :|::.|..|
  Fly   107 SDPLVRAIYE--------------------DLLKHGTL----FKECPIRSGTYSL-TNYNVDEEM 146

  Fly   164  163
              Fly   147  146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:461928 16/80 (20%)
CG14455NP_649402.2 DM8 87..179 CDD:214778 16/85 (19%)

Return to query results.
Submit another query.