DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33689 and CG14455

Sequence 1:NP_001027132.2 Gene:CG33689 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_649402.2 Gene:CG14455 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster

Alignment Length:130 Identity:27/131 (21%)
Similarity:50/131 (38%) Gaps:43/131 (33%)


  Fly    51 KYVDVYVNLY------KLPID----------NITISFRLMRHDHGYKPFFIDYTFDGCKFLRNQ- 98
            |::|:.|:|.      .|.||          .:.:.|.| ..|.|.....|:.|.:.||.::.: 
  Fly    43 KFLDLKVDLQNDSGESNLSIDIKTHQDIEDVQLVVDFGL-ETDKGNYSTLINRTLNFCKLMKQRN 106

  Fly    99 KHPIIKLFYKIYQGSSNINHTCPYDHDIIVDHLWTGNIESDFLKYIPMINGDYAVYSNWSTDNIM 163
            ..|:::..|:                    |.|..|.:    .|..|:.:|.|:: :|::.|..|
  Fly   107 SDPLVRAIYE--------------------DLLKHGTL----FKECPIRSGTYSL-TNYNVDEEM 146

  Fly   164  163
              Fly   147  146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 16/81 (20%)
CG14455NP_649402.2 DM8 87..179 CDD:214778 16/86 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.