DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33689 and CG33632

Sequence 1:NP_001027132.2 Gene:CG33689 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001036537.1 Gene:CG33632 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster

Alignment Length:159 Identity:59/160 (37%)
Similarity:102/160 (64%) Gaps:1/160 (1%)


  Fly    14 LMAIHTHMTFTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPIDNITISFRLMRHDH 78
            |..:::.:.|||::|.:.|..|::|:.|::::|||::|||.:.|.|.|:|:..|.:.|.|.:..:
  Fly    19 LTEVYSLVEFTNVQCETLDKDFSLFEYCYLQSVNRSYKYVSLKVKLLKIPVTKIKVQFGLYKRLN 83

  Fly    79 GYKPFFIDYTFDGCKFLRNQK-HPIIKLFYKIYQGSSNINHTCPYDHDIIVDHLWTGNIESDFLK 142
            |||||..:.|.|||:||:::. :||...||.:::..|||||||||:||:::|.:...:|.....:
  Fly    84 GYKPFLYNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCPYNHDLVLDEMSYHSINYKLTE 148

  Fly   143 YIPMINGDYAVYSNWSTDNIMRAYLNLYF 171
            .:|...|:|.:..:|...:|.||....||
  Fly   149 ILPFPEGNYKLEVHWIAYDIDRAITTFYF 177

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 32/81 (40%)
CG33632NP_001036537.1 DUF1091 74..159 CDD:284008 33/85 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.