DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33689 and CG33632

DIOPT Version :9

Sequence 1:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster


Alignment Length:159 Identity:59/159 - (37%)
Similarity:102/159 - (64%) Gaps:1/159 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LMAIHTHMTFTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPIDNITISFRLMRHDH 78
            |..:::.:.|||::|.:.|..|::|:.|::::|||::|||.:.|.|.|:|:..|.:.|.|.:..:
  Fly    19 LTEVYSLVEFTNVQCETLDKDFSLFEYCYLQSVNRSYKYVSLKVKLLKIPVTKIKVQFGLYKRLN 83

  Fly    79 GYKPFFIDYTFDGCKFLRNQK-HPIIKLFYKIYQGSSNINHTCPYDHDIIVDHLWTGNIESDFLK 142
            |||||..:.|.|||:||:::. :||...||.:::..|||||||||:||:::|.:...:|.....:
  Fly    84 GYKPFLYNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCPYNHDLVLDEMSYHSINYKLTE 148

  Fly   143 YIPMINGDYAVYSNWSTDNIMRAYLNLYF 171
            .:|...|:|.:..:|...:|.||....||
  Fly   149 ILPFPEGNYKLEVHWIAYDIDRAITTFYF 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 32/80 (40%)
CG33632NP_001036537.1 DUF1091 74..159 CDD:284008 33/84 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
66.060

Return to query results.
Submit another query.