DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33689 and CG13590

Sequence 1:NP_001027132.2 Gene:CG33689 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_611919.1 Gene:CG13590 FlyBaseID:FBgn0035012 Length:193 Species:Drosophila melanogaster

Alignment Length:179 Identity:57/180 (32%)
Similarity:93/180 (52%) Gaps:21/180 (12%)


  Fly     7 VFIIMGSLMAIH------THMTFTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPID 65
            |||...||:..:      .::..||..|.|.:.::.:...|.:||.:|....:::.|...: |..
  Fly     5 VFIFAVSLLVAYLSCGEAPYLKMTNAVCKSYNKSWVVVHYCRLKAYSRAKTSLNINVTFVE-PAR 68

  Fly    66 NITISFRLMRHDHGYKPFFIDYTFDGCKFLRNQKHPIIKLFYKIYQGSSNINHTCPYDHDIIVDH 130
            ||::.|:.|:..:|||||..|||||.|:|:|.:..|:.|:.:.:.:..|.|||||||:       
  Fly    69 NISVHFKTMKKANGYKPFLFDYTFDACEFMRRRNQPVAKIIWYMIRNVSTINHTCPYE------- 126

  Fly   131 LWTG-NIESDFLKY---IPMINGDYAVYSNWSTDNIMRAYLNLYFRVTE 175
               | .:.|||.|.   :|:.:|||.:..:|..|...:...|:||...|
  Fly   127 ---GLQMLSDFHKVDIPVPLPSGDYLLMVDWLFDGKTQFATNVYFTFIE 172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 33/84 (39%)
CG13590NP_611919.1 DM8 83..171 CDD:214778 36/98 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.