DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33689 and CG33919

Sequence 1:NP_001027132.2 Gene:CG33689 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027393.1 Gene:CG33919 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster

Alignment Length:138 Identity:34/139 (24%)
Similarity:66/139 (47%) Gaps:17/139 (12%)


  Fly    41 CFIKAVNRTHKYVDVYVNLYKLPIDNITISFRLMRHDHG--YKPFFIDYTFDGCKFLRNQKH-PI 102
            |.:||:|.....|::...:. :|:.|..|..::...|:.  ||||.:|.....|:.:..:.. |.
  Fly    43 CHVKAINWNLAVVNMDCFMI-VPLHNPIIRMQVFTKDYSNQYKPFLVDVKIRICEVIERRNFIPY 106

  Fly   103 IKLFYKIYQGSSNINHTCPYDHDIIVDHLWTGNIESDFLKYIPMINGDYAV------YSNWSTDN 161
            ..:.:|:::..:|:||:||:...:|..   .|.:::..|.  |...|.|.|      .::.|||.
  Fly   107 GVIMWKLFKRYTNVNHSCPFSGHLIAR---DGFLDTSLLP--PFPQGFYQVSLVVTDTNSTSTDY 166

  Fly   162 I--MRAYL 167
            :  |:.:|
  Fly   167 VGTMKFFL 174

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 20/83 (24%)
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 21/87 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.