DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33689 and CG33690

Sequence 1:NP_001027132.2 Gene:CG33689 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027133.1 Gene:CG33690 FlyBaseID:FBgn0053690 Length:170 Species:Drosophila melanogaster

Alignment Length:162 Identity:76/163 (47%)
Similarity:113/163 (69%) Gaps:6/163 (4%)


  Fly    15 MAIHTHMTFTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPIDNITISFRLMRHDHG 79
            |....|:||||:.|.|.:..|..|..|.||||||||||:.:|..|.::||.:..:||..:     
  Fly    15 MICFCHVTFTNLNCSSYNLDFMSFPTCRIKAVNRTHKYISIYAKLNQVPIVDARVSFGQI----- 74

  Fly    80 YKPFFIDYTFDGCKFLRNQKHPIIKLFYKIYQGSSNINHTCPYDHDIIVDHLWTGNIESDFLKYI 144
             |||..|.::|||||::.||:.::|.||:.:|.::|||||||||||:|||.|:|||:|.:|.::|
  Fly    75 -KPFLYDLSYDGCKFMKTQKNVLVKTFYRTFQRNTNINHTCPYDHDLIVDKLFTGNLEEEFGRFI 138

  Fly   145 PMINGDYAVYSNWSTDNIMRAYLNLYFRVTER 176
            .:.|||||:|::|:|:.|.||.:.:|.::..|
  Fly   139 IIPNGDYAIYTDWATNKISRASVKIYLKILNR 170

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 41/80 (51%)
CG33690NP_001027133.1 DUF1091 68..147 CDD:284008 43/85 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.