DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33689 and CG33914

DIOPT Version :10

Sequence 1:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster


Alignment Length:181 Identity:54/181 - (29%)
Similarity:92/181 - (50%) Gaps:11/181 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RLFNVFIIMGSLMAIH-THMTFTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPIDN 66
            :|..:.:.:..|..:| ..|.|||:.|.|||.:.:|.:.|.:..:::....:.:...:.|....|
  Fly     7 KLLGLLLCLLFLTELHGVFMRFTNVTCESKDLSMSIVEYCAVTTLSKNKNSISLRYAMLKPMFTN 71

  Fly    67 ITISFRLMRHD-------HGYKPFFIDYTFDGCKFLRNQKHPIIKLFYKIYQGSSNINHTCPYDH 124
            |.|.|:||...       ..::||......|.|:|.:|..:.:.::.::...|.:|:||||||..
  Fly    72 IEIYFQLMTRGSESIHAASNWQPFLHTMKLDLCRFWKNHHNHLARMVFEFIDGHTNMNHTCPYTK 136

  Fly   125 D--IIVDHLWTGNIESDFLKYIPMINGDYAVYSNWSTDNIMRAYLNLYFRV 173
            :  |.:|.| |....|..::.:||..|.||:::.|||:||.|...|.||.|
  Fly   137 EKYISIDDL-TNTEVSAKIRGVPMPKGFYALFTTWSTENITRVVTNFYFEV 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:461928 25/88 (28%)
CG33914NP_001027394.2 DUF1091 88..166 CDD:461928 23/78 (29%)

Return to query results.
Submit another query.