DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33689 and CG33914

Sequence 1:NP_001027132.2 Gene:CG33689 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027394.2 Gene:CG33914 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster

Alignment Length:181 Identity:54/182 (30%)
Similarity:92/182 (51%) Gaps:11/182 (6%)


  Fly     3 RLFNVFIIMGSLMAIH-THMTFTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPIDN 66
            :|..:.:.:..|..:| ..|.|||:.|.|||.:.:|.:.|.:..:::....:.:...:.|....|
  Fly     7 KLLGLLLCLLFLTELHGVFMRFTNVTCESKDLSMSIVEYCAVTTLSKNKNSISLRYAMLKPMFTN 71

  Fly    67 ITISFRLMRHD-------HGYKPFFIDYTFDGCKFLRNQKHPIIKLFYKIYQGSSNINHTCPYDH 124
            |.|.|:||...       ..::||......|.|:|.:|..:.:.::.::...|.:|:||||||..
  Fly    72 IEIYFQLMTRGSESIHAASNWQPFLHTMKLDLCRFWKNHHNHLARMVFEFIDGHTNMNHTCPYTK 136

  Fly   125 D--IIVDHLWTGNIESDFLKYIPMINGDYAVYSNWSTDNIMRAYLNLYFRV 173
            :  |.:|.| |....|..::.:||..|.||:::.|||:||.|...|.||.|
  Fly   137 EKYISIDDL-TNTEVSAKIRGVPMPKGFYALFTTWSTENITRVVTNFYFEV 186

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 26/89 (29%)
CG33914NP_001027394.2 DUF1091 85..166 CDD:284008 24/82 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.