DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33689 and CG33912

DIOPT Version :10

Sequence 1:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027139.1 Gene:CG33912 / 3772438 FlyBaseID:FBgn0053912 Length:165 Species:Drosophila melanogaster


Alignment Length:173 Identity:57/173 - (32%)
Similarity:92/173 - (53%) Gaps:16/173 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LFNVFIIMGS--LMAIHTHMTFTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPIDN 66
            ||..|::..:  ...:::.:.|.|::|.|.|..||:.:.|::|:|||::|||.:.|||.||||..
  Fly     7 LFISFLMYSTCYFTEVYSLVEFANVQCESLDKDFALIEYCYLKSVNRSYKYVSIKVNLLKLPISK 71

  Fly    67 ITISFRLMRHDHGYKPFFIDYTFDGCKFLRNQKHPIIKLFYKIYQGSSNINHTCPYDHDIIVDHL 131
            :.|.|.|.:...|||||..:.|.|.||||::.....:.||:.|              |||::|.:
  Fly    72 VKIRFGLYKRFTGYKPFLYNATLDACKFLKSPNSNPVALFFII--------------HDIVLDKM 122

  Fly   132 WTGNIESDFLKYIPMINGDYAVYSNWSTDNIMRAYLNLYFRVT 174
            ...::.:...|.:|...|.|.:..:|....|.||...||:.:|
  Fly   123 SYHSVNNKLTKILPFPEGHYMIEIHWIAYEINRAITKLYWTLT 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:461928 23/79 (29%)
CG33912NP_001027139.1 DUF1091 74..>145 CDD:461928 25/84 (30%)

Return to query results.
Submit another query.