DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33689 and CG33758

DIOPT Version :10

Sequence 1:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027397.1 Gene:CG33758 / 3772381 FlyBaseID:FBgn0053758 Length:178 Species:Drosophila melanogaster


Alignment Length:166 Identity:37/166 - (22%)
Similarity:72/166 - (43%) Gaps:21/166 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VFIIMGSLMAIHTHMTFTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPIDNITISF 71
            :|..:..|.:......|.::.|.:.|..|..|..|.:||::|....:.|...| |.|:..|.|..
  Fly     5 LFFTLLVLTSTEVEAKFKSLHCAAFDQDFGEFLLCKLKAISRLRNSISVQYKL-KQPVSKIFIRL 68

  Fly    72 RLMRHDHGYKPFFIDYTFDGCKFLRNQKHPIIKLFYKIYQGSSNINHTCPY-----------DHD 125
            ...:..:|::||..::|.:.|.||....:.|:.:.|...:.....|::||:           |.:
  Fly    69 EFFKRANGWRPFLYNFTANLCDFLARNNNVIMGIGYAYLRPYLVKNYSCPFKVIENELLECKDFE 133

  Fly   126 IIVDHLWTGNIESDFLKYIPMINGDYAVYSNWSTDN 161
            :.::     |:.:.|    |:..|:||:...:...|
  Fly   134 LDIN-----NLRNRF----PIETGEYALQLTFIAKN 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:461928 18/90 (20%)
CG33758NP_001027397.1 DUF1091 66..152 CDD:461928 19/94 (20%)

Return to query results.
Submit another query.