DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33689 and CG33764

DIOPT Version :9

Sequence 1:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027107.1 Gene:CG33764 / 3772289 FlyBaseID:FBgn0053764 Length:180 Species:Drosophila melanogaster


Alignment Length:177 Identity:66/177 - (37%)
Similarity:104/177 - (58%) Gaps:10/177 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NVFIIMGSLMAIHTHMT-------FTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLP 63
            |:|:  .||:.:..::|       ||||:|.|.|..||:|...|:|:|||::|||.|.|.|.|:|
  Fly     6 NLFV--ASLILLTYYITEIYSVVKFTNIQCQSLDRDFALFDSWFLKSVNRSYKYVSVKVKLLKIP 68

  Fly    64 IDNITISFRLMRHDHGYKPFFIDYTFDGCKFLRN-QKHPIIKLFYKIYQGSSNINHTCPYDHDII 127
            :..:.:.|.|.:..:||.||..:.:||.|:||.: ..:|:...||..::..|||||:||:|||||
  Fly    69 VSKVKVRFGLYKRVNGYMPFLYNMSFDACRFLTSPNPNPVALYFYNFFKDYSNINHSCPFDHDII 133

  Fly   128 VDHLWTGNIESDFLKYIPMINGDYAVYSNWSTDNIMRAYLNLYFRVT 174
            :|.:...:|.:...|.:|...|.|.:..:|...:|.||....|:.:|
  Fly   134 LDKMPYHSINNKVTKILPFPEGKYMIEMHWIAYDIDRAITKFYWTLT 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 31/80 (39%)
CG33764NP_001027107.1 DUF1091 74..159 CDD:284008 32/84 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
66.060

Return to query results.
Submit another query.