DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33689 and CG33792

Sequence 1:NP_001027132.2 Gene:CG33689 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027411.2 Gene:CG33792 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster

Alignment Length:206 Identity:48/207 (23%)
Similarity:85/207 (41%) Gaps:48/207 (23%)


  Fly     9 IIMGSLMAIHTHMTFTN--------IKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPID 65
            :.:|.|:.:...:.::|        .:|.:....|:.. .|.:|.||.|...:::..:: |..:.
  Fly    11 VYLGVLLCLPNTIFYSNGYFFKIRKTECIANGAYFSNV-SCILKPVNWTRSVLNMDGDI-KEALT 73

  Fly    66 NITISFRLMRHDHG--YKPFFIDYTFDGCKFLRN-------QKHPIIKLFYKIYQGSSNINHTCP 121
            :|.:|..:...|..  ||||.:.:.||.|:.|:|       ||:.|..|     ...:|:||:||
  Fly    74 DIKMSVEVFYKDSSNLYKPFAVKFKFDVCQLLKNKTQSNFLQKYAISHL-----TEWTNVNHSCP 133

  Fly   122 YDHDIIV------------------DHLWTGNIESD--FLKYIPMINGDYAVYSNWSTDN--IMR 164
            |...:.:                  .||...|...|  .|..:|:  .||.:..|:|..|  |..
  Fly   134 YRVSLCIYNIVKFSQYIEYIYMFLKGHLIARNFRLDEVSLPILPI--QDYKIAFNFSGANPGIHL 196

  Fly   165 AYLNLYFRVTE 175
            ..:.:||.:.|
  Fly   197 GLVLIYFEILE 207

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 28/109 (26%)
CG33792NP_001027411.2 DUF1091 82..183 CDD:284008 28/108 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.