DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33689 and CG33643

DIOPT Version :10

Sequence 1:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027258.1 Gene:CG33643 / 3772011 FlyBaseID:FBgn0053643 Length:178 Species:Drosophila melanogaster


Alignment Length:85 Identity:20/85 - (23%)
Similarity:41/85 - (48%) Gaps:17/85 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 DGCKFLRN-QKHPIIKLFYKIYQGSSNINHTCPY--DHDIIVDHLWTGNIESDFLKYIPMINGDY 151
            |.|..|.: ||:.::.::.|.::..||:.  ||.  :.:..:.:|:..  |.||..::|  :|.:
  Fly    93 DACLLLGSIQKNRLVNIYSKTFKRFSNVE--CPLKANFNYTMKNLYMD--EQDFPSFVP--SGTF 151

  Fly   152 AVYSNWSTDNIMRAYLNLYF 171
            .        :::..|||..|
  Fly   152 R--------SLIEFYLNQTF 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:461928 16/65 (25%)
CG33643NP_001027258.1 DUF1091 79..152 CDD:461928 16/64 (25%)

Return to query results.
Submit another query.