DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or59b and Or33a

Sequence 1:NP_523822.1 Gene:Or59b FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_523553.1 Gene:Or33a FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster

Alignment Length:394 Identity:99/395 (25%)
Similarity:174/395 (44%) Gaps:48/395 (12%)


  Fly    15 KVQSRQGNIYLYRAMWLIGWIPPKEGVLRYVYLFWTCVPF---AFGVFYLPVGFIIS-----YVQ 71
            ||:|..    ||:..||...:...||    .|.|...|.|   :|.....||..|:.     .:|
  Fly     6 KVRSEN----LYKTYWLYWRLLGVEG----DYPFRRLVDFTITSFITILFPVHLILGMYKKPQIQ 62

  Fly    72 EFKNFTPGEFLTSLQVCINVYGASVKSTITYLFLWRLR--KT-EILLDSLDKRLANDSDR----- 128
            .|::.   .|.:....|         |...:.|.|:|:  || |.||..||.|:.::.:|     
  Fly    63 VFRSL---HFTSECLFC---------SYKFFCFRWKLKEIKTIEGLLQDLDSRVESEEERNYFNQ 115

  Fly   129 --ERIHNMVARCNYAFLIYSFIYCGYAG--STFLSYALSGRPPWSVYNPFIDWRDGMGSLWIQAI 189
              .|:..|:::......|.:.|....||  ||..:....|   |..|    |::......||...
  Fly   116 NPSRVARMLSKSYLVAAISAIITATVAGLFSTGRNLMYLG---WFPY----DFQATAAIYWISFS 173

  Fly   190 FEYITMSFAVLQDQLSDTYPLMFTIMFRAHMEVLKDHVRSLRMDPERSEADNYQDLVNCVLDHKT 254
            ::.|..|..:|::..:|:||.:...:...|:.:|...:..:..|.:.|.::|.:.|:..:.||:.
  Fly   174 YQAIGSSLLILENLANDSYPPITFCVVSGHVRLLIMRLSRIGHDVKLSSSENTRKLIEGIQDHRK 238

  Fly   255 ILKCCDMIRPMISRTIFVQFALIGSVLGLTLVNVFFFS-NFWKGVASLLFVITILLQTFPFCYTC 318
            ::|...::|..:..:...||...|..:.:||:|:.||: |.:..:...:|...:|::.||.||..
  Fly   239 LMKIIRLLRSTLHLSQLGQFLSSGINISITLINILFFAENNFAMLYYAVFFAAMLIELFPSCYYG 303

  Fly   319 NMLIDDAQDLSNEIFQSNWVDAEPRYKATLVLFMHHVQQPIIFIAGGIFPISMNSNITVAKFAFS 383
            .::..:...|...||.|||:..:.||..:|::.|.....|:...||||..|.|::.....:.|:|
  Fly   304 ILMTMEFDKLPYAIFSSNWLKMDKRYNRSLIILMQLTLVPVNIKAGGIVGIDMSAFFATVRMAYS 368

  Fly   384 IITI 387
            ..|:
  Fly   369 FYTL 372

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 78/318 (25%)
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 80/325 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5163119
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.