DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: yellow-d2 and RGN

Sequence 1:NP_611788.1 Gene:yellow-d2 FlyBaseID:FBgn0034856 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_004674.1 Gene:RGN HGNCID:9989 Length:299 Species:Homo sapiens

Alignment Length:273 Identity:55/274 (20%)
Similarity:93/274 (34%) Gaps:94/274 (34%)


  Fly   190 PHNCDVGFVYMADSIGDGIVVYDVAAQQSWRIEN------KFTYPHPDFGTFTIAGESFQLWDGT 248
            |.||..|...:.:.:.:.::..|:.|::..|.::      :.|...|      ::..:.:...|.
Human    11 PENCRCGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAP------VSSVALRQSGGY 69

  Fly   249 VSTTLTPHGLGGRRMMYFHSLSSEWQMAIPLDVVNNG-SNWRLND--VSAALDQFQLLGKRGSQC 310
            |:|..|.          |.:|:.:.|.|:.|..|:|. .|.|.||  |..|...|  .|....:.
Human    70 VATIGTK----------FCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYF--AGTMAEET 122

  Fly   311 VAAAMS------------------------ESG----------FLICGLVQPASLLAWNIRTG-Y 340
            ..|.:.                        .:|          :.|..|........::::|| .
Human   123 APAVLERHQGALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQI 187

  Fly   341 SHQNLVMLVEDEQRLQFASGLKIVRNHEGKEELW--------------VLSNRLQK--------- 382
            |::..|..:|.|:  |...|:.|  :.|||  ||              |...|||.         
Human   188 SNRRSVYKLEKEE--QIPDGMCI--DAEGK--LWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTT 246

  Fly   383 --AFGAGLDYKEI 393
              .|| |.:|.|:
Human   247 SCCFG-GKNYSEM 258

Known Domains:


GeneSequenceDomainRegion External IDIdentity
yellow-d2NP_611788.1 MRJP 122..411 CDD:281074 55/274 (20%)
RGNNP_004674.1 SGL 16..264 CDD:312077 52/269 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.