DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: yellow-d2 and yellow-h

Sequence 1:NP_611788.1 Gene:yellow-d2 FlyBaseID:FBgn0034856 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_651912.3 Gene:yellow-h FlyBaseID:FBgn0039896 Length:463 Species:Drosophila melanogaster

Alignment Length:406 Identity:118/407 (29%)
Similarity:207/407 (51%) Gaps:24/407 (6%)


  Fly    18 SAQALESVFGAYNLELEFPSPQERQRALRDGLYDPGSVIPIDVDVYYKHGDATPSIFVTIPRFAK 82
            |...||.|:....|:..:.:..:||:::.:|.:.|.:.:|:.:||:...      :|||.||:..
  Fly    49 SESQLEIVYEWKYLDFLYSTFVQRQQSILNGDFVPKNNLPLGIDVHNNR------LFVTTPRWKN 107

  Fly    83 GVPYSLAYVTNEMRPNGTLLQAYPSYEWH-KSHGADCNGLTSVYRTQIDECGRMWILDSG----E 142
            |||.||..:....:.:...::.||::|.| ..:..||:.|.|||||.:|.|.|:|::|||    .
  Fly   108 GVPASLGTLPFPPKESSPAIKPYPNWEAHGNPNNPDCSKLMSVYRTAVDRCDRIWLIDSGIVNAT 172

  Fly   143 IDFIQHCPPQLYAIDLESGKVAHQYKMPKRLYKEGV--SRFVTPTVELDPHNCDVGFVYMADSIG 205
            |:..|.|||::...||:|.::..:|.:.....|:..  |..|....|    :||.....::|...
  Fly   173 INLNQICPPKIVVYDLKSDELIVRYNLEASHVKQDSLHSNIVVDIGE----DCDDAHAIVSDVWR 233

  Fly   206 DGIVVYDVAAQQSWRIENKFTYPHPDFGTFTIAGESFQLWDGTVSTTLTPHGLGGRRMMYFHSLS 270
            .|::||.::..:|||:.|...||.|....|.:.|.:||..||....::..:.....|::|||.::
  Fly   234 FGLLVYSLSKNRSWRVTNYNFYPDPFASDFNVYGLNFQWLDGVFGMSIYYNKKIMERVLYFHPMA 298

  Fly   271 SEWQMAIPLDVVNNGSNWRLNDVSAALDQFQLLGKRG--SQCVAAAMSESGFLICGLVQPASLLA 333
            |..:..:|::::.|.|.|:.|....| ..|..:|.||  ||...:.::.:|.:....|....:..
  Fly   299 SFKEFMVPMNILLNESVWQTNTQEYA-KYFIPIGDRGYNSQSSTSGVTRNGIMFFTQVHQDDIGC 362

  Fly   334 WNIRTGYSHQNLVML--VEDEQRLQFASGLKIVRNHEGKEELWVLSNRLQKAFGAGLDYKEINFR 396
            |:....|:..:|...  :|:...:||.:.||:  :.|..:.:|::||||.....:.|||.|:|||
  Fly   363 WDTSKPYTRAHLGKFHNMENSNLIQFPNDLKV--DKEKDQNVWLISNRLPIFLYSNLDYGEVNFR 425

  Fly   397 IQKCGVQELLSGRPCN 412
            |.|..|.:::....||
  Fly   426 ILKANVNKIIRNSVCN 441

Known Domains:


GeneSequenceDomainRegion External IDIdentity
yellow-d2NP_611788.1 MRJP 122..411 CDD:281074 87/299 (29%)
yellow-hNP_651912.3 MRJP 148..440 CDD:281074 87/299 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134615056
eggNOG 1 0.900 E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10009
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.