DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: yellow-d2 and smp-30

Sequence 1:NP_611788.1 Gene:yellow-d2 FlyBaseID:FBgn0034856 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001262580.1 Gene:smp-30 FlyBaseID:FBgn0038257 Length:306 Species:Drosophila melanogaster

Alignment Length:303 Identity:56/304 (18%)
Similarity:101/304 (33%) Gaps:125/304 (41%)


  Fly     7 FGVCC--------WCWLAASAQALESVFGAYNLELEFPSPQERQRALRDGLYDP-----GSVIPI 58
            |.|.|        |..::|.|:...::|     |::   |..::..|.|...||     |..:..
  Fly    75 FAVGCGLRTVIVQWDGVSAVAKVTRTLF-----EVQ---PDLKENRLNDAKTDPNGRFYGGTMAD 131

  Fly    59 DVDVY---------YKHGDATPSIFVTIPRFAKGVPYSLAYVTNEMR------PNGTLLQAYPSY 108
            ..|::         ::.|....:|     |...|:...||:.....:      .|..:|    :|
  Fly   132 SGDIFTQWKGELYSWQAGGQPNAI-----RSKVGISNGLAWDVKAKKFYFIDTNNHEVL----AY 187

  Fly   109 EWHKSHGADCN-------------------GLTSVYRTQIDECGRMWI--LDSGEIDFIQHCPPQ 152
            ::::|.||..|                   |:|      :|..|.:::  .:.|.:         
  Fly   188 DYNQSTGAVSNPKVIFDLRKIRPEGPLFPDGMT------VDTDGNIYVATFNGGTV--------- 237

  Fly   153 LYAIDLESGKVAHQYKMPKRLYKEGVSRFVTPTVELDPHNCDVGFVYMADSIGDGIVVYDVAAQQ 217
             :.::..:||:..:.|:|        :..:| :|.....|.|:.:|..|                
  Fly   238 -FKVNPSTGKILLEIKIP--------TTQIT-SVAFGGPNLDILYVTTA---------------- 276

  Fly   218 SWRIENKFTYPHPDFGTFTIAGESFQLWDGTVSTTLTPHGLGG 260
                 |||..|.|       ||.:||:      |.|...|..|
  Fly   277 -----NKFDQPKP-------AGTTFQV------TGLNAKGYAG 301

Known Domains:


GeneSequenceDomainRegion External IDIdentity
yellow-d2NP_611788.1 MRJP 122..411 CDD:281074 27/142 (19%)
smp-30NP_001262580.1 SGL 18..277 CDD:285626 43/265 (16%)
NHL 168..>248 CDD:302697 14/100 (14%)
NHL repeat 168..208 CDD:271320 7/44 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.