DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: yellow-d2 and yellow-e

Sequence 1:NP_611788.1 Gene:yellow-d2 FlyBaseID:FBgn0034856 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_524344.1 Gene:yellow-e FlyBaseID:FBgn0041711 Length:530 Species:Drosophila melanogaster

Alignment Length:429 Identity:115/430 (27%)
Similarity:194/430 (45%) Gaps:57/430 (13%)


  Fly     1 MERWIVFGVCCWCWLAASAQALESVFGA--------YNLELEFPSPQERQRALRDGLYDPGSVIP 57
            |.|.:|..:|...|...| |||......        ||.|.:.|...       ...|:|.:|:.
  Fly     1 MIRILVGVICAVLWSPVS-QALTPGLQVAKQWKLLRYNFEPQAPVSD-------PNFYNPQNVLI 57

  Fly    58 IDVDVYYKHGDATPSIFVTIPRFAKGVPYSLAYVTNEMRPNGTLLQAYPSYEWHKSHGADCNG-- 120
            ..:.|      ....|||..|:...|||.::::|:.....:...|.|:|.:.:..:..:|.|.  
  Fly    58 TGLAV------TDDRIFVATPKLFSGVPSTVSWVSKAQFGDSPTLNAFPDWTFSNTGRSDFNCSD 116

  Fly   121 --LTSVYRTQIDECGRMWILDSGEI----DFIQHCPPQLYAIDLESGKVAHQYKMPKRLYKEGVS 179
              ||||||.::|.|.|:|:||:|..    |:...|||::..:||.:.:|..:...|..:.: |.|
  Fly   117 LILTSVYRLRVDSCNRIWLLDAGISRSLEDYEITCPPKILVVDLATDRVVRRIDFPPEVLR-GES 180

  Fly   180 RFVTPTV-ELDPHNCDVGFVYMADSIGDGIVVYDVAAQQSWRIENKFTYPHPDFGTFTIAGESFQ 243
            .|....: |.....||..|||:.|::..||:|||.....:||:.:...||.|||....|....|.
  Fly   181 LFTNMVIDETTAKGCDDVFVYITDTVEPGIIVYDSGKDVTWRVSHPAMYPDPDFAQSEIHEHRFV 245

  Fly   244 LWDGTVSTTLTPHGLGGRRMMYFHSLSSEWQMAIPLDVVNNG--SNWRLNDVSAALDQFQLLGKR 306
            |.||.|..|....    ..::||..|:::...::..:|:..|  .:.::.||       :|:||:
  Fly   246 LMDGVVGLTFDER----TGVVYFQPLATDRVFSVHKNVLRAGPLPDGKMLDV-------KLVGKK 299

  Fly   307 GSQCVAAAMS--ESGFLICGLVQPASLLAWNIRTGYSHQNLVMLVEDEQRLQFASGLKIVRNHEG 369
            .||.:..|:|  :|..:...|.:.| :.:||..|....    :|..|..:|||.:.:...::..|
  Fly   300 SSQGIGLAVSPFDSSLIFSPLSETA-IASWNPTTNQQS----VLAFDRDQLQFVADITTTKSEPG 359

  Fly   370 KEELWVLSNRLQKAFGAGLDYKEINFRIQKCGVQELLSG 408
              .::.::::..:.|...|:..|.|.||.:.   ||.:|
  Fly   360 --VIYAIASKFHRFFLKNLNPNEFNNRIVRL---ELPAG 393

Known Domains:


GeneSequenceDomainRegion External IDIdentity
yellow-d2NP_611788.1 MRJP 122..411 CDD:281074 84/297 (28%)
yellow-eNP_524344.1 MRJP 120..393 CDD:281074 83/295 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134615663
eggNOG 1 0.900 E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10009
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.