DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-d2 and yellow-e

DIOPT Version :9

Sequence 1:NP_611788.1 Gene:yellow-d2 / 37704 FlyBaseID:FBgn0034856 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_524344.1 Gene:yellow-e / 41653 FlyBaseID:FBgn0041711 Length:530 Species:Drosophila melanogaster


Alignment Length:429 Identity:115/429 - (26%)
Similarity:194/429 - (45%) Gaps:57/429 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWIVFGVCCWCWLAASAQALESVFGA--------YNLELEFPSPQERQRALRDGLYDPGSVIP 57
            |.|.:|..:|...|...| |||......        ||.|.:.|...       ...|:|.:|:.
  Fly     1 MIRILVGVICAVLWSPVS-QALTPGLQVAKQWKLLRYNFEPQAPVSD-------PNFYNPQNVLI 57

  Fly    58 IDVDVYYKHGDATPSIFVTIPRFAKGVPYSLAYVTNEMRPNGTLLQAYPSYEWHKSHGADCNG-- 120
            ..:.|      ....|||..|:...|||.::::|:.....:...|.|:|.:.:..:..:|.|.  
  Fly    58 TGLAV------TDDRIFVATPKLFSGVPSTVSWVSKAQFGDSPTLNAFPDWTFSNTGRSDFNCSD 116

  Fly   121 --LTSVYRTQIDECGRMWILDSGEI----DFIQHCPPQLYAIDLESGKVAHQYKMPKRLYKEGVS 179
              ||||||.::|.|.|:|:||:|..    |:...|||::..:||.:.:|..:...|..:.: |.|
  Fly   117 LILTSVYRLRVDSCNRIWLLDAGISRSLEDYEITCPPKILVVDLATDRVVRRIDFPPEVLR-GES 180

  Fly   180 RFVTPTV-ELDPHNCDVGFVYMADSIGDGIVVYDVAAQQSWRIENKFTYPHPDFGTFTIAGESFQ 243
            .|....: |.....||..|||:.|::..||:|||.....:||:.:...||.|||....|....|.
  Fly   181 LFTNMVIDETTAKGCDDVFVYITDTVEPGIIVYDSGKDVTWRVSHPAMYPDPDFAQSEIHEHRFV 245

  Fly   244 LWDGTVSTTLTPHGLGGRRMMYFHSLSSEWQMAIPLDVVNNG--SNWRLNDVSAALDQFQLLGKR 306
            |.||.|..|....    ..::||..|:::...::..:|:..|  .:.::.||       :|:||:
  Fly   246 LMDGVVGLTFDER----TGVVYFQPLATDRVFSVHKNVLRAGPLPDGKMLDV-------KLVGKK 299

  Fly   307 GSQCVAAAMS--ESGFLICGLVQPASLLAWNIRTGYSHQNLVMLVEDEQRLQFASGLKIVRNHEG 369
            .||.:..|:|  :|..:...|.:.| :.:||..|....    :|..|..:|||.:.:...::..|
  Fly   300 SSQGIGLAVSPFDSSLIFSPLSETA-IASWNPTTNQQS----VLAFDRDQLQFVADITTTKSEPG 359

  Fly   370 KEELWVLSNRLQKAFGAGLDYKEINFRIQKCGVQELLSG 408
              .::.::::..:.|...|:..|.|.||.:.   ||.:|
  Fly   360 --VIYAIASKFHRFFLKNLNPNEFNNRIVRL---ELPAG 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-d2NP_611788.1 MRJP 122..411 CDD:281074 84/296 (28%)
yellow-eNP_524344.1 MRJP 120..393 CDD:281074 83/294 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449237
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D940689at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.