DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: yellow-d2 and yellow-e2

Sequence 1:NP_611788.1 Gene:yellow-d2 FlyBaseID:FBgn0034856 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_650289.2 Gene:yellow-e2 FlyBaseID:FBgn0038151 Length:435 Species:Drosophila melanogaster

Alignment Length:392 Identity:209/393 (53%)
Similarity:276/393 (70%) Gaps:6/393 (2%)


  Fly    25 VFGAYNLELEFPSPQERQRALRDGLYDPGSVIPIDVDVYYKHGDATPSIFVTIPRFAKGVPYSLA 89
            ||...||:..|||.|||.:.||:|.|:|.|.||||:||||......|..|||.|||.:|||:||.
  Fly    44 VFEWKNLQYGFPSEQERDQVLRNGRYNPDSPIPIDIDVYYPPNGGPPRHFVTSPRFGQGVPFSLG 108

  Fly    90 YVTNEMRPNGTLLQAYPSYEWHKSHGADCNGLTSVYRTQIDECGRMWILDSGEIDFIQHCPPQLY 154
            ||||..|.||:.:||||||:||.||||:|:|||||||..||.||:||:||||||:|:|||.||:.
  Fly   109 YVTNVQRENGSEIQAYPSYQWHSSHGANCDGLTSVYRVHIDACGQMWVLDSGEIEFVQHCAPQVM 173

  Fly   155 AIDLESGKVAHQYKMPKRLYKEGVSRFVTPTVEL-DP---HNCDVGFVYMADSIGDGIVVYDVAA 215
            ..||.:.::.|:|::|:..||..|||||....:: ||   ..|...|.|:||.....||||||..
  Fly   174 VFDLATDQLIHRYRLPETSYKAKVSRFVNIFADIRDPPPSGQCKDVFAYLADPTSKAIVVYDVVG 238

  Fly   216 QQSWRIENKFTYPHPDFGTFTIAGESFQLWDGTVSTTLTPHGLGGRRMMYFHSLSSEWQMAIPLD 280
            |.|||||||||||...|||.|:|||||:|.||.::...||.|||.||.:.||:||:|.::|||||
  Fly   239 QSSWRIENKFTYPDAKFGTHTVAGESFELLDGPLALATTPLGLGLRRHLIFHALSNELELAIPLD 303

  Fly   281 VVNNGSNWRLNDVSAALDQFQLLGKRGSQCVAAAMSESGFLICGLVQPASLLAWNIRTGYSHQNL 345
            ::||.:||: ..:|::|.:|.:|||||.||.:.|:|..|||.||.::|..:..|:||..|:.:|:
  Fly   304 ILNNATNWQ-KGLSSSLSEFTVLGKRGIQCASHAISRQGFLFCGFLEPIGIFGWDIRRPYNRENV 367

  Fly   346 VMLVEDEQRLQFASGLKIVRN-HEGKEELWVLSNRLQKAFGAGLDYKEINFRIQKCGVQELLSGR 409
            .:|..:...|||.||:||||. .:|:||||:||:||||.|...:||:|||:|:.:|.|.:||.||
  Fly   368 KLLAINPATLQFVSGMKIVRRPADGREELWLLSDRLQKIFAGTIDYREINYRVMRCDVDDLLQGR 432

  Fly   410 PC 411
            .|
  Fly   433 GC 434

Known Domains:


GeneSequenceDomainRegion External IDIdentity
yellow-d2NP_611788.1 MRJP 122..411 CDD:281074 150/294 (51%)
yellow-e2NP_650289.2 MRJP 141..434 CDD:281074 150/294 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134614476
eggNOG 1 0.900 E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10009
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.