DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: yellow-d2 and yellow-f2

Sequence 1:NP_611788.1 Gene:yellow-d2 FlyBaseID:FBgn0034856 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_650247.1 Gene:yellow-f2 FlyBaseID:FBgn0038105 Length:452 Species:Drosophila melanogaster

Alignment Length:338 Identity:91/339 (27%)
Similarity:164/339 (48%) Gaps:22/339 (6%)


  Fly    73 IFVTIPRFAKGVPYSLAYVTNEMRPNGT----LLQAYPSYEWHKSHGADCNGLTSVYRTQIDECG 133
            :|||:||...|:|.:|.|:  ::..:|:    .|:|||::..:: ..|....|.|||||.:|.|.
  Fly   113 LFVTMPRRRVGIPSTLNYI--DLAEDGSNRSPKLRAYPNFALNQ-FNASAENLVSVYRTSVDACQ 174

  Fly   134 RMWILDSGEIDF----IQHCPPQLYAIDLESGKVAHQYKMPKRLYKEGVSRFVTPTVELDPHNCD 194
            |:|.:|:|.:::    .|...|.::.:||.:.:|..::.:|:.:.:.| ....:.||::....|.
  Fly   175 RLWFIDTGMLEYPNNRQQIRRPSIWVVDLATDQVLKRFDVPESIAETG-RGLASITVDVKAGQCG 238

  Fly   195 VGFVYMADSIGDGIVVYDVAAQQSWRIENKFTYPHPDFGTFTIAGESFQLWDGTVSTTLTPHGLG 259
            ..:.|:.|.:...:.||.:...:.|..|:.:....|..|..:|.|::|:..||..|.||....|.
  Fly   239 DAYAYIPDLVYRRLYVYHLRNDRIWSFEHNYFNFDPLSGDLSIGGQTFRWDDGIFSITLGAQKLD 303

  Fly   260 GRRMMYFHSLSSEWQMAIPLDVVNNGSNWRLNDVSAALDQFQLLGKRG--SQCVAAAMSE-SGFL 321
            |.|..|||.::|..:..:...|:...||...:|..   :.|::||.||  :|....|... :|.:
  Fly   304 GSRDAYFHPMASTNEFVVSNRVLQQESNAARSDHG---NDFRVLGSRGPSTQSTMHAYDPGTGVI 365

  Fly   322 ICGLVQPASLLAWNIRTGYSHQNLVMLVEDEQRLQFASGLKIVRNHEGKEELWVLSNRLQKAFGA 386
            ....:|...:..|......|.:|...:..:.:.:.:.|.|.|  :.:|  .:||:||.:.....:
  Fly   366 FFDEIQRNGVGCWKTSKPISAENYGSVDSNAEDMIYPSDLSI--DEDG--TIWVMSNSMPIFIYS 426

  Fly   387 GLDYKEINFRIQK 399
            .||....||||.|
  Fly   427 TLDTSIYNFRIWK 439

Known Domains:


GeneSequenceDomainRegion External IDIdentity
yellow-d2NP_611788.1 MRJP 122..411 CDD:281074 75/286 (26%)
yellow-f2NP_650247.1 MRJP 163..451 CDD:281074 75/286 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134615412
eggNOG 1 0.900 E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10009
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.