DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: yellow-d2 and yellow-f

Sequence 1:NP_611788.1 Gene:yellow-d2 FlyBaseID:FBgn0034856 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_524335.1 Gene:yellow-f FlyBaseID:FBgn0041710 Length:429 Species:Drosophila melanogaster

Alignment Length:338 Identity:91/339 (27%)
Similarity:168/339 (50%) Gaps:26/339 (8%)


  Fly    73 IFVTIPRFAKGVPYSLAYVTNEMRPNG----TLLQAYPSYEWHKSHGADCNGLTSVYRTQIDECG 133
            :|||:||...|:|.:|.|:  ::..:|    ..|:|||:...::.:.::.| |.|||||.:|.||
  Fly    90 LFVTVPRRQPGIPSTLNYI--DLAKDGWSQSPHLRAYPNLAVNQYNASEQN-LVSVYRTSVDVCG 151

  Fly   134 RMWILDSGEIDF------IQHCPPQLYAIDLESGKVAHQYKMPKRLYKEGVSRFVTPTVELDPHN 192
            |:|.:|:|.::|      |:|  |.::.|||.:.::..::::|:.:.:.| ....:.|:::....
  Fly   152 RLWFVDTGMLEFPNNRQQIRH--PSIWVIDLANDRLLKRFEIPQSIVEIG-RGLASITIDVGARR 213

  Fly   193 CDVGFVYMADSIGDGIVVYDVAAQQSWRIENKFTYPHPDFGTFTIAGESFQLWDGTVSTTLTPHG 257
            |:..:.|:.|.:...:.||.:.:.:.|..|:.|....|......|.|::|:..||..|.||..:.
  Fly   214 CNDAYAYIPDLVNRRLHVYHLRSDRIWSFEHSFFNFDPLSDNLNIGGQTFRWDDGIFSATLGSYK 278

  Fly   258 LGGRRMMYFHSLSSEWQMAIPLDVVNNGSNWRLNDVSAALDQFQLLGKRGSQCVAAAMS---ESG 319
            ..|.|.::||.::|..:..:...|:....|...:|..   |.|.|||.||....:....   .:|
  Fly   279 PDGSRDVFFHPMASTNEFVVSNRVLQQEFNAARSDHG---DDFHLLGTRGPSTQSTMHKYDPRTG 340

  Fly   320 FLICGLVQPASLLAWNIRTGYSHQNLVMLVEDEQRLQFASGLKIVRNHEGKEELWVLSNRLQKAF 384
            .:....||.:.:..|.....:|.:|...:..:...:.:.|.|.|  :.||  .:||:||.:....
  Fly   341 VIFFAEVQKSGVGCWKTSKPFSTENHGSVYSNSSEMIYPSDLTI--DEEG--YIWVMSNSMPIFV 401

  Fly   385 GAGLDYKEINFRI 397
            .:.||.::.||||
  Fly   402 YSKLDVEKYNFRI 414

Known Domains:


GeneSequenceDomainRegion External IDIdentity
yellow-d2NP_611788.1 MRJP 122..411 CDD:281074 75/286 (26%)
yellow-fNP_524335.1 MRJP 140..428 CDD:281074 75/286 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134615331
eggNOG 1 0.900 E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10009
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.