DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: yellow-d2 and yellow-k

Sequence 1:NP_611788.1 Gene:yellow-d2 FlyBaseID:FBgn0034856 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_648772.1 Gene:yellow-k FlyBaseID:FBgn0036504 Length:342 Species:Drosophila melanogaster

Alignment Length:406 Identity:87/407 (21%)
Similarity:146/407 (36%) Gaps:130/407 (32%)


  Fly    14 WLAASAQALESVFGAYNLELEFPSPQERQRALRDGLYDPGSVIPIDVDVYYKHGDATPSIFVTIP 78
            ||.:.:...||.:...:|.:.|                  |.:.:.|:|  :..||...|....|
  Fly    23 WLLSESGLNESSYKVRHLSMHF------------------SRVFLSVNV--ESNDAPTLIEAQWP 67

  Fly    79 RFAKGVPYSLAYVTNEMRPNGTLLQAYPSYEWHK--SHGADCNGLTSVYRTQIDECGRMWILDSG 141
                     ::|.     |..|::  :|..:.|.  .|. ||:.:...:.:|:|...|:|::|.|
  Fly    68 ---------VSYF-----PMPTVV--FPHIDVHSMGDHD-DCSLVQQAHWSQVDALSRLWVMDIG 115

  Fly   142 EIDFIQHCPPQLYAIDLESGKV-------AHQYKMPKRLYKEGVSRFVTPTVELDP------HNC 193
            ...  ..|.|:|:..||.....       .|..         |.:.....||::.|      |..
  Fly   116 FPG--STCSPRLFVFDLMRNNAELLRIDCGHHI---------GANDTHFLTVQMGPKSPGCEHER 169

  Fly   194 DVGFVYMADSIG--DGIVVYDVAAQQSW--------RIEN---KFTYPHPDFGTFTIAGE---SF 242
            .:.|:     :|  ..|:.||: .:|:|        :.||   .|.....|| .|.|.||   |.
  Fly   170 HIYFI-----LGKVPEILAYDI-LEQTWHRLSLESNKYENMNQSFPIKPVDF-IFGIQGELILSD 227

  Fly   243 QLWDGTVSTTLTPHGLGGRRMMYFHSLSSEWQMAIPLDVVNNGSNWRLNDVSAALDQFQLLGKRG 307
            |  ||.:.:|:             ..|..|.:..:....:||  :.:|..:.:      |||...
  Fly   228 Q--DGDLYSTV-------------DRLEIEGKSELASKPINN--SIKLTHLGS------LLGSSR 269

  Fly   308 SQCVAAAMSESGFLI-----CGLVQPASLLAWNIRTGYSHQNLVMLVEDEQRLQFASGLKIVRNH 367
            |..:    ...|.|.     .|.|...:.|| || |...::.:.:..::.|::.|.|        
  Fly   270 SMII----DNFGTLYYVIPKFGAVVRCAKLA-NI-TAEGNEIIYITSKNIQQIFFTS-------- 320

  Fly   368 EGKEELWVLSNRLQKA 383
              .:.|||||:|:..|
  Fly   321 --NDALWVLSDRVLNA 334

Known Domains:


GeneSequenceDomainRegion External IDIdentity
yellow-d2NP_611788.1 MRJP 122..411 CDD:281074 66/297 (22%)
yellow-kNP_648772.1 MRJP 102..>201 CDD:281074 24/116 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134616414
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10009
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.