DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: yellow-d2 and y

Sequence 1:NP_611788.1 Gene:yellow-d2 FlyBaseID:FBgn0034856 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_476792.1 Gene:y FlyBaseID:FBgn0004034 Length:541 Species:Drosophila melanogaster

Alignment Length:425 Identity:120/426 (28%)
Similarity:206/426 (48%) Gaps:41/426 (10%)


  Fly     4 WIVFGVCCWCWLAASAQALESVFGAYNLELEFPSPQERQRALRDGLYDPGSVIPIDVDVYYKHGD 68
            ||:..:......:.:|..|:..:....|:..||:.:.:.:||..|.|.|.:.:|:.|:.:...  
  Fly     7 WILVTLITLVTPSWAAYKLQERYSWSQLDFAFPNTRLKDQALASGDYIPQNALPVGVEHFGNR-- 69

  Fly    69 ATPSIFVTIPRFAKGVPYSLAYVTNEMRPNGT-LLQAYPSYEWHKSHGADC-NGLTSVYRTQIDE 131
                :|||:||:..|:|.:|.|:..:....|: .|..||  :|..:...|| |.:|:.||.::||
  Fly    70 ----LFVTVPRWRDGIPATLTYINMDRSLTGSPELIPYP--DWRSNTAGDCANSITTAYRIKVDE 128

  Fly   132 CGRMWILDSGEIDF----IQHCPPQLYAIDLESGKVAHQYKMPKRLYKEGV----SRFVTPTVEL 188
            |||:|:||:|.:..    ...||..:...||.:.....:|::|      ||    :.|:. .:.:
  Fly   129 CGRLWVLDTGTVGIGNTTTNPCPYAVNVFDLTTDTRIRRYELP------GVDTNPNTFIA-NIAV 186

  Fly   189 D-PHNCDVGFVYMADSIGDGIVVYDVAAQQSWRIE-NKFTYPHPDFGTFTIAGESFQLW--DGTV 249
            | ..|||..:.|.||.:|.|::.|.....:|||.. :.:.:|.|..|.|.:||.:|| |  :|..
  Fly   187 DIGKNCDDAYAYFADELGYGLIAYSWELNKSWRFSAHSYFFPDPLRGDFNVAGINFQ-WGEEGIF 250

  Fly   250 STTLTPHGLGGRRMMYFHSLSSEWQMAIPLDVVNNGSNWRLNDVSAALDQFQLLGKRG--SQCVA 312
            ..:|:|....|.|.:||..|:|..|.|:...::.:.:  |..|   :...|..|.:||  |...:
  Fly   251 GMSLSPIRSDGYRTLYFSPLASHRQFAVSTRILRDET--RTED---SYHDFVALDERGPNSHTTS 310

  Fly   313 AAMSESGFLICGLVQPASLLAWNIRTGYSHQNLVMLVEDEQRLQFASGLKIVRNHEGKEELWVLS 377
            ..||:.|..:..|:...::..|:....||.|...::..|:..|.|.:.:||..|    :.:||||
  Fly   311 RVMSDDGIELFNLIDQNAVGCWHSSMPYSPQFHGIVDRDDVGLVFPADVKIDEN----KNVWVLS 371

  Fly   378 NRLQKAFGAGLDYKEINFRIQKCGVQELLSGRPCN 412
            :|:.....:.|||.:.||||....:..|:....|:
  Fly   372 DRMPVFLLSDLDYSDTNFRIYTAPLATLIENTVCD 406

Known Domains:


GeneSequenceDomainRegion External IDIdentity
yellow-d2NP_611788.1 MRJP 122..411 CDD:281074 88/303 (29%)
yNP_476792.1 MRJP 119..405 CDD:281074 88/303 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134615247
eggNOG 1 0.900 E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10009
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.