DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: yellow-d2 and Rgn

Sequence 1:NP_611788.1 Gene:yellow-d2 FlyBaseID:FBgn0034856 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_033086.1 Gene:Rgn MGIID:108024 Length:299 Species:Mus musculus

Alignment Length:220 Identity:47/221 (21%)
Similarity:75/221 (34%) Gaps:84/221 (38%)


  Fly   210 VYDVAAQQSWRIENKFTYPHPDFGTFTIAGESFQLWDGTVSTTLTPHGLGGRRMMYFHSLSSEWQ 274
            |:.:|.....:..|:|     :.|....||..|.   ||::....|..| .|.....:||..:..
Mouse    87 VFVLAMVDEDKKNNRF-----NDGKVDPAGRYFA---GTMAEETAPAVL-ERHQGSLYSLFPDHS 142

  Fly   275 MAIPLDVV--NNGSNWRL--------NDVSAALDQFQLLGKRGSQCVAAAMSESGFLICGLVQPA 329
            :....|.|  :||.:|.|        :.:|..:|.|.                            
Mouse   143 VKKYFDQVDISNGLDWSLDHKIFYYIDSLSYTVDAFD---------------------------- 179

  Fly   330 SLLAWNIRTG-YSHQNLVMLVEDEQRLQFASGLKIVRNHEGKEELWV--------------LSNR 379
                ::::|| .|::.:|..:|.::  |...|:.|  :.|||  |||              ...|
Mouse   180 ----YDLQTGQISNRRIVYKMEKDE--QIPDGMCI--DAEGK--LWVACYNGGRVIRLDPETGKR 234

  Fly   380 LQK-----------AFGAGLDYKEI 393
            ||.           .|| |.||.|:
Mouse   235 LQTVKLPVDKTTSCCFG-GKDYSEM 258

Known Domains:


GeneSequenceDomainRegion External IDIdentity
yellow-d2NP_611788.1 MRJP 122..411 CDD:281074 47/221 (21%)
RgnNP_033086.1 SGL 16..264 CDD:285626 47/221 (21%)
NHL 166..>237 CDD:302697 20/109 (18%)
NHL repeat 203..237 CDD:271320 11/38 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.