DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-d2 and Rgn

DIOPT Version :9

Sequence 1:NP_611788.1 Gene:yellow-d2 / 37704 FlyBaseID:FBgn0034856 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_033086.1 Gene:Rgn / 19733 MGIID:108024 Length:299 Species:Mus musculus


Alignment Length:186 Identity:35/186 - (18%)
Similarity:63/186 - (33%) Gaps:42/186 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 GKVAHQYKMPKRLYKEGVSRFVTPTVELDPHNCDVGFVYMADSIGDGIVVYDVAAQQSWRIENKF 225
            |||.     |...|..|.....|....|:.|...:..::...|:.......|::....|.:::|.
Mouse   105 GKVD-----PAGRYFAGTMAEETAPAVLERHQGSLYSLFPDHSVKKYFDQVDISNGLDWSLDHKI 164

  Fly   226 TYPHPDFGTFTIAGESFQLWDGTVSTTLTPHGLGGRRMMYFHSLSSEWQMAIPLDVVNNGSNW-- 288
            .| :.|..::|:....:.|..|.:|         .||::|  .:..:.|:...:.:...|..|  
Mouse   165 FY-YIDSLSYTVDAFDYDLQTGQIS---------NRRIVY--KMEKDEQIPDGMCIDAEGKLWVA 217

  Fly   289 ----------------RLNDVSAALDQFQLL---GKRGSQ----CVAAAMSESGFL 321
                            ||..|...:|:....   ||..|:    |....::..|.|
Mouse   218 CYNGGRVIRLDPETGKRLQTVKLPVDKTTSCCFGGKDYSEMYVTCARDGLNAEGLL 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-d2NP_611788.1 MRJP 122..411 CDD:281074 35/186 (19%)
RgnNP_033086.1 SGL 16..264 CDD:400653 33/175 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.