DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: yellow-d and smp-30

Sequence 1:NP_523820.2 Gene:yellow-d FlyBaseID:FBgn0041712 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001262580.1 Gene:smp-30 FlyBaseID:FBgn0038257 Length:306 Species:Drosophila melanogaster

Alignment Length:139 Identity:28/140 (20%)
Similarity:44/140 (31%) Gaps:37/140 (26%)


  Fly   220 YHGLVVYDHQAQTSWRAENRFMY-------PDPDYGKHTIA--------GESFYLMDGMFALNND 269
            |.|.:.......|.|:.|   :|       |:....|..|:        .:.||.:|     .|:
  Fly   125 YGGTMADSGDIFTQWKGE---LYSWQAGGQPNAIRSKVGISNGLAWDVKAKKFYFID-----TNN 181

  Fly   270 KRNLYFHPLASASEYSVPLSALNRQQNWANGPEALPEEFRLLGRRRSECAASAIDGRNNVYCVTF 334
            ...|.:....|....|.|....:.::....|| ..|:             ...:|...|:|..||
  Fly   182 HEVLAYDYNQSTGAVSNPKVIFDLRKIRPEGP-LFPD-------------GMTVDTDGNIYVATF 232

  Fly   335 NPVKLFVWN 343
            |...:|..|
  Fly   233 NGGTVFKVN 241

Known Domains:


GeneSequenceDomainRegion External IDIdentity
yellow-dNP_523820.2 MRJP 133..413 CDD:281074 28/140 (20%)
smp-30NP_001262580.1 SGL 18..277 CDD:285626 28/140 (20%)
NHL 168..>248 CDD:302697 19/94 (20%)
NHL repeat 168..208 CDD:271320 8/45 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.