DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: yellow-d and yellow-f

Sequence 1:NP_523820.2 Gene:yellow-d FlyBaseID:FBgn0041712 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_524335.1 Gene:yellow-f FlyBaseID:FBgn0041710 Length:429 Species:Drosophila melanogaster

Alignment Length:447 Identity:113/448 (25%)
Similarity:198/448 (44%) Gaps:71/448 (16%)


  Fly     3 MMPLRILLI----AFSLTLAQSYGVGVNGPRPVRTVETLTQWGQLEF-----GFPTAQDR----- 53
            |:.|.:||:    .|.|.      :..:|...:.    :.:|.||:|     |:....:|     
  Fly     1 MLSLDVLLLCAISGFQLL------ISADGDPMIE----VFKWKQLDFYNRGDGYKDLWNRICIPD 55

  Fly    54 ---------ENAQAAGNLVPENGTPIDVQPQYMANGQIRLFTTIPRFVTGIPYTLATVS-ATQG- 107
                     ..:.::|:.:..|..     ||.:.:.:.|||.|:||...|||.||..:. |..| 
  Fly    56 SHFYNSRKCLGSSSSGSFIQYNNV-----PQGVTHFRGRLFVTVPRRQPGIPSTLNYIDLAKDGW 115

  Fly   108 RNGPLLQPYPNYSWHNANGEDCDRITSAFRVAITECNQMWVIDSGVI----GTTQLCPPQLLQFA 168
            ...|.|:.|||.:.:..|..: ..:.|.:|.::..|.::|.:|:|::    ...|:..|.:....
  Fly   116 SQSPHLRAYPNLAVNQYNASE-QNLVSVYRTSVDVCGRLWFVDTGMLEFPNNRQQIRHPSIWVID 179

  Fly   169 LATDRLLHRFRFPND-TYIPSGSLFITPNVLVQDPPPRGTCSRTMIYVADVSYHGLVVYDHQAQT 232
            ||.||||.||..|.. ..|..|...||.:|..:      .|:....|:.|:....|.||..::..
  Fly   180 LANDRLLKRFEIPQSIVEIGRGLASITIDVGAR------RCNDAYAYIPDLVNRRLHVYHLRSDR 238

  Fly   233 SWRAENRFMYPDPDYGKHTIAGESFYLMDGMFALN------NDKRNLYFHPLASASEYSVPLSAL 291
            .|..|:.|...||......|.|::|...||:|:..      :..|:::|||:||.:|:.|....|
  Fly   239 IWSFEHSFFNFDPLSDNLNIGGQTFRWDDGIFSATLGSYKPDGSRDVFFHPMASTNEFVVSNRVL 303

  Fly   292 NRQQNWANGPEALPEEFRLLGRR--RSECAASAIDGRNNVYCVTFNPVK---LFVWNVNSPYNSR 351
            .::.|.|.....  ::|.|||.|  .::......|.|..|  :.|..|:   :..|..:.|:::.
  Fly   304 QQEFNAARSDHG--DDFHLLGTRGPSTQSTMHKYDPRTGV--IFFAEVQKSGVGCWKTSKPFSTE 364

  Fly   352 NFGNLPAKSDDLQFVSGMKVLRNREGQEELWMLSNRYQKIAAGTLNSKEVNFRILRR 408
            |.|::.:.|.::.:.|.:.:  :.||.  :|::||.........|:.::.||||.|:
  Fly   365 NHGSVYSNSSEMIYPSDLTI--DEEGY--IWVMSNSMPIFVYSKLDVEKYNFRIWRQ 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
yellow-dNP_523820.2 MRJP 133..413 CDD:281074 77/293 (26%)
yellow-fNP_524335.1 MRJP 140..428 CDD:281074 77/293 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134615290
eggNOG 1 0.900 E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10009
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.