DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: yellow-d and yellow-d2

Sequence 1:NP_523820.2 Gene:yellow-d FlyBaseID:FBgn0041712 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_611788.1 Gene:yellow-d2 FlyBaseID:FBgn0034856 Length:412 Species:Drosophila melanogaster

Alignment Length:382 Identity:158/383 (41%)
Similarity:220/383 (57%) Gaps:12/383 (3%)


  Fly    43 LEFGFPTAQDRENAQAAGNLVPENGTPIDVQPQYM-ANGQIRLFTTIPRFVTGIPYTLATVSATQ 106
            ||..||:.|:|:.|...|...|.:..||||...|. .:....:|.|||||..|:||:||.|:...
  Fly    31 LELEFPSPQERQRALRDGLYDPGSVIPIDVDVYYKHGDATPSIFVTIPRFAKGVPYSLAYVTNEM 95

  Fly   107 GRNGPLLQPYPNYSWHNANGEDCDRITSAFRVAITECNQMWVIDSGVIGTTQLCPPQLLQFALAT 171
            ..||.|||.||:|.||.::|.||:.:||.:|..|.||.:||::|||.|...|.|||||....|.:
  Fly    96 RPNGTLLQAYPSYEWHKSHGADCNGLTSVYRTQIDECGRMWILDSGEIDFIQHCPPQLYAIDLES 160

  Fly   172 DRLLHRFRFPNDTYIPSGSLFITPNVLVQDPPPRGTCSRTMIYVADVSYHGLVVYDHQAQTSWRA 236
            .::.|:::.|...|....|.|:||.|.: ||   ..|....:|:||....|:||||..||.|||.
  Fly   161 GKVAHQYKMPKRLYKEGVSRFVTPTVEL-DP---HNCDVGFVYMADSIGDGIVVYDVAAQQSWRI 221

  Fly   237 ENRFMYPDPDYGKHTIAGESFYLMDGMFALN------NDKRNLYFHPLASASEYSVPLSALNRQQ 295
            ||:|.||.||:|..|||||||.|.||..:..      ..:|.:|||.|:|..:.::||..:|...
  Fly   222 ENKFTYPHPDFGTFTIAGESFQLWDGTVSTTLTPHGLGGRRMMYFHSLSSEWQMAIPLDVVNNGS 286

  Fly   296 NW-ANGPEALPEEFRLLGRRRSECAASAIDGRNNVYCVTFNPVKLFVWNVNSPYNSRNFGNLPAK 359
            || .|...|..::|:|||:|.|:|.|:|:.....:.|....|..|..||:.:.|:.:|...|...
  Fly   287 NWRLNDVSAALDQFQLLGKRGSQCVAAAMSESGFLICGLVQPASLLAWNIRTGYSHQNLVMLVED 351

  Fly   360 SDDLQFVSGMKVLRNREGQEELWMLSNRYQKIAAGTLNSKEVNFRILRRKLDDVQGG 416
            ...|||.||:|::||.||:||||:||||.||.....|:.||:||||.:..:.::..|
  Fly   352 EQRLQFASGLKIVRNHEGKEELWVLSNRLQKAFGAGLDYKEINFRIQKCGVQELLSG 408

Known Domains:


GeneSequenceDomainRegion External IDIdentity
yellow-dNP_523820.2 MRJP 133..413 CDD:281074 118/287 (41%)
yellow-d2NP_611788.1 MRJP 122..411 CDD:281074 119/292 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134614525
eggNOG 1 0.900 E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10009
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.