DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: yellow-d and yellow-b

Sequence 1:NP_523820.2 Gene:yellow-d FlyBaseID:FBgn0041712 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001285987.1 Gene:yellow-b FlyBaseID:FBgn0032601 Length:453 Species:Drosophila melanogaster

Alignment Length:427 Identity:128/428 (30%)
Similarity:196/428 (46%) Gaps:73/428 (17%)


  Fly    39 QWGQLEFGFPTAQDRENAQAAGNLVPENGTPIDVQPQYMANGQIRLFTTIPRFVTGIPYTLATVS 103
            :|.:::|.:.....|.:|...|...|.|..|..::    ..|. |||.|:||:..|:|.:||.:.
  Fly    27 EWREMDFKYANPDQRWSAIERGEFKPANVIPFGLE----VAGH-RLFVTLPRWRDGVPASLAYLD 86

  Fly   104 ATQ-GRNGPLLQPYPNYSWHNANGEDCDRITSAFRVAITECNQMWVID---SGVIGTTQLC-PPQ 163
            ... ...||.|:|:|::..||.. |....:.|.|||....|.::||:|   |||:..|::. ..|
  Fly    87 LNDTSSKGPALKPFPSWQAHNLQ-EAEPELVSPFRVRADRCGRLWVLDSRISGVLEQTKIYGAAQ 150

  Fly   164 LLQFALATDRLLHRFRFPNDTYIPSGSL---FITPNVLVQDPPPRGTCSRTMIYVADVSYHGLVV 225
            ||.:.|..|.||.|.      .:|:|.|   .:..|:.|:|    ..|..|..|.||:...||||
  Fly   151 LLVYDLHNDDLLRRH------VLPAGQLKQGSLLANLAVED----SDCENTFAYAADLGSPGLVV 205

  Fly   226 YDHQAQTSWRAENRFMYPDPDYGKHTIAGESFYLMDGMFALNNDK------RNLYFHPLASASEY 284
            |..:.:.|||.::.|.:|||..|..:|.|..|...||::.|...|      ..||||||.|.:|:
  Fly   206 YSWKDEESWRVQHHFFHPDPMAGNFSINGIEFQWDDGLYGLALSKPLETGYATLYFHPLCSTTEF 270

  Fly   285 SVPLSALNRQQNWANGPEALPEEFRLLGRRRSECAAS-------------AIDGRNNVYCVTFNP 336
            ||..|.| |.:..|..| .:..||::||.|.....|.             |:...|.|.|     
  Fly   271 SVDTSIL-RNKTLATSP-MIYREFKVLGSRGPNTQAGAEFLDPDTGVLFYALPNLNEVAC----- 328

  Fly   337 VKLFVWNVNSPYNSRNFGNLPAKSDDLQFVSGMKVLRNREGQEELWMLSNR-----YQKIAAGTL 396
                 |...:.::..:...:...:|.|.|.|.:||    :.|:.||:|||:     |.::.||: 
  Fly   329 -----WRTATDFSHSSQSRIHMNNDTLVFPSDIKV----DDQKRLWVLSNQLPVFIYDELYAGS- 383

  Fly   397 NSKEVNFRIL----RRKLDDVQGGVFFSNDEDLTNRL 429
                :|||||    :..:::....:..|...|:.|:|
  Fly   384 ----INFRILTASVKEAIENTACEIRTSPLPDVINKL 416

Known Domains:


GeneSequenceDomainRegion External IDIdentity
yellow-dNP_523820.2 MRJP 133..413 CDD:281074 97/315 (31%)
yellow-bNP_001285987.1 MRJP 116..402 CDD:281074 97/317 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134615451
eggNOG 1 0.900 E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10009
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.