DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Golgin245 and MLP1

Sequence 1:NP_611787.2 Gene:Golgin245 FlyBaseID:FBgn0034854 Length:1489 Species:Drosophila melanogaster
Sequence 2:NP_013021.1 Gene:MLP1 SGDID:S000001803 Length:1875 Species:Saccharomyces cerevisiae

Alignment Length:1871 Identity:379/1872 (20%)
Similarity:715/1872 (38%) Gaps:557/1872 (30%)


  Fly    54 ITEEDTP-------QNSPYRIQKLPATSASALR------GRSTQSLNGATSRTRKLSNSSMASDV 105
            :::.|||       :||..|:..:.:....:|.      |...:.||....:..:|.:.::...|
Yeast     1 MSDHDTPMESIQNGENSDERLNAIASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSENLKVTV 65

  Fly   106 SF-RLPTYEAPAVYHLQSDLDETSSEFDDSASTARLDVITKDQLYDAYKKSLDRYHKY-RCRYTD 168
            || .|.......:..|:::::....| :|.....|.|...|.:..:..|..|....:: :.:..|
Yeast    66 SFDELKASSLKKIDGLKTEMENVIRE-NDKIRKERNDTFVKFESVENEKMKLSSELEFVKRKLDD 129

  Fly   169 LAKKYKELERDSSKARSVLVETQDKALRRISELREQCTLEQQAKAHLEEALRVEMDDMSCKMQAY 233
            |.::.||.:.:..:...:|    |:.|:.|..:|    :|........:.||..:.|:..|.|.|
Yeast   130 LTEEKKETQSNQQRTLKIL----DERLKEIELVR----VENNRSNSECKKLRSTIMDLETKQQGY 186

  Fly   234 QTKLQLLGENPENITAALERSGQQL----------------ESEQLI------------------ 264
            .|       |..|....|||..|:|                ::||.:                  
Yeast   187 IT-------NDLNSRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIRNELN 244

  Fly   265 ---------------------DLEESIGKSPLSTNG------------SSGVSDLQRLLKERDEQ 296
                                 :|.:|:.:..|...|            |:.:|..|||:...:.|
Yeast   245 RLRNDFQMERTNNDVLKQKNNELSKSLQEKLLEIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQ 309

  Fly   297 LKSVTEKYEAVRKQEEENVLLLAQTKQAIHTELELKDTEVRKLQEKLKQLESQ---------RES 352
            |.:|.|:..::|:.....|:.....||....|..||:.::.|  |||.|.|.:         ...
Yeast   310 LNAVKEELNSIRELNTAKVIADDSKKQTPENEDLLKELQLTK--EKLAQCEKECLRLSSITDEAD 372

  Fly   353 HNNE------------VKEQFKKLQATKQ----EVDAKLMATEH---LLNTLKESYAIKEQQVVT 398
            .:||            :|:|..|.:.||:    :::..::..||   ::|:.||...:.|.::..
Yeast   373 EDNENLSAKSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPIINSFKERTDMLENELNN 437

  Fly   399 LEAQLEAIRVENEQKVKDLQKQNED---------------------------RNTQASDSSEQLK 436
            ....||....|...|||:|..:|:.                           .|:.::||...|:
Yeast   438 AALLLEHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDLCRQIQYLLITNSVSNDSKGPLR 502

  Fly   437 K-----LQAAVQDAESQLLSKD------------------------------------------- 453
            |     :|..:|:.:|.:...|                                           
Yeast   503 KEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNIIQLQEKNAELLKVVRNLADKLESKEKKS 567

  Fly   454 ----QLLES------------LRSEQAAKEQQLKHLKEQLGKLK----QENENY----LDKLREN 494
                |.:||            |:||:...|.:::.|:::|.:||    .|:.:|    :.:|.|.
Yeast   568 KQSLQKIESETVNEAKEAIITLKSEKMDLESRIEELQKELEELKTSVPNEDASYSNVTIKQLTET 632

  Fly   495 KKSSDSQTNEAQDQQKKL-QAAKDEAESKLLATEEL--LHSLRNDYKAQ-----------EEKVA 545
            |:..:||   .||.|.:: |..::..|:..|..:|:  |:..::|...:           ||:..
Yeast   633 KRDLESQ---VQDLQTRISQITRESTENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFK 694

  Fly   546 LLEDKLKTLSKENDVNVEKLHHINEQREAQSTDSQQKINELRAAKDEAEAKLLSTEHSLNALQAA 610
            ||.:.|.....|||...::..::......|.:.:.:.:||..:.|  ::..::.||        .
Yeast   695 LLSNTLDLTKAENDQLRKRFDYLQNTILKQDSKTHETLNEYVSCK--SKLSIVETE--------L 749

  Fly   611 LSAKEEQ------AASLEQSLNALKTESEH------SLQDLRLHNDQLLEIVQRHQQNDWEAQLA 663
            |:.||||      ..:|:|.||.|..|.:.      .||.|:...:.|||..::..|...: :|.
Yeast   750 LNLKEEQKLRVHLEKNLKQELNKLSPEKDSLRIMVTQLQTLQKEREDLLEETRKSCQKKID-ELE 813

  Fly   664 RAREELAAIQSQRELHALELE--------------KSLEMERESVAALNSEKASQEEQHRLKLEQ 714
            .|..||....||::.|..:||              ::|:.:.|||......|.:..|:.:.|::.
Yeast   814 DALSELKKETSQKDHHIKQLEEDNNSNIEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKS 878

  Fly   715 LQREIQ---------ILQDQHANSES----------------ETVAALKGQLEALSQDLA----- 749
            |::||:         .:.|:..|.:|                ..:...|...|..||.|.     
Yeast   879 LEKEIEEDKIRLHTYNVMDETINDDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSK 943

  Fly   750 --------TSQASLLAKEK---ELKAS---------GNKLNKIKKQHEQHQAKSSDQSARLEALQ 794
                    |:|...|..||   |.|.|         .|:|:..||..|:.:|   |...|:..||
Yeast   944 LDESFKDFTNQIKNLTDEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKA---DFKKRISILQ 1005

  Fly   795 SELADRLSHSRQVESEKEELQARVTGILEEI-------GTMQAQMQQVQDSHSELEREKRKLESR 852
                   :::::||:.|.|.:::::.|..::       .|.|...:|....|:::.:...:|..:
Yeast  1006 -------NNNKEVEAVKSEYESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQ 1063

  Fly   853 IE---------SLQQEQVDSSAQDERTS------AKLEEIQSENTK---LAERNCLLEEQ----- 894
            :.         :|.::|::::.::...|      :.||::...|::   |:.:|.||.:|     
Yeast  1064 LHTYKGQVKTLNLSRDQLENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYT 1128

  Fly   895 --------------TNHLESQLQAKQD------------------EIGKIQAKLQQVLDEHSKLQ 927
                          .|::...|:.::|                  :|..:..:||   |..:||.
Yeast  1129 AADKEVNNSTNGPGLNNILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQ---DARTKLD 1190

  Fly   928 NAQELMDHDHRTLQDKCDAYEK-DKL-LTKHTLDCLQSASEELHRVKANLDRELKEQDQ------ 984
            |::...::....:|...|..|| ::| |.:.:...|::..|..:..|..|..||.:..|      
Yeast  1191 NSRVEKENHSSIIQQHDDIMEKLNQLNLLRESNITLRNELENNNNKKKELQSELDKLKQNVAPIE 1255

  Fly   985 -QLSELRERQREQEQQLKDQAERCAKLKAQ-----------NSESETQLQATISNLREQLDAYKQ 1037
             :|:.|:...:|:||:||...|...:.|.:           :|....:|::.|.||:|:|:..::
Yeast  1256 SELTALKYSMQEKEQELKLAKEEVHRWKKRSQDILEKHEQLSSSDYEKLESEIENLKEELENKER 1320

  Fly  1038 TEQGIQEKLQATNSSYTTQIATLEARWSAANSDVERLHEANDALQLEMEQLKIKHGQEREEVKES 1102
            .....:||..........::.|.:....:....|..|.:|.:.|:                  .|
Yeast  1321 QGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLE------------------NS 1367

  Fly  1103 IAQKNRQVVELQEAMATRDRQLQEKIEASEKLAKFDEILIENEYLNKHTKQLEAELAESAELKEK 1167
            :::.|.::.|||.|...   |...::||..||         .|...|.:::|:|:|.||....|.
Yeast  1368 LSEANARIEELQNAKVA---QGNNQLEAIRKL---------QEDAEKASRELQAKLEESTTSYES 1420

  Fly  1168 -LKSLQCELYVLQEKAEQHAVQMAEKETQSATATAE------VSELKKAIEEQAVELTRQKEHAS 1225
             :..|..|:..|:|:.|:.  :..:::.|:.:|..:      |..:||:.||..::         
Yeast  1421 TINGLNEEITTLKEEIEKQ--RQIQQQLQATSANEQNDLSNIVESMKKSFEEDKIK--------- 1474

  Fly  1226 FVTEQSDAVQKDLLQAQQQLHDK---QIELAMSRDEQALLQAEADGLRQEVICLKEHLSPSTDSD 1287
            |:.|::..|.:.:|:||::|:..   .:|....:.|....|..:..:|:....||:.:...|:  
Yeast  1475 FIKEKTQEVNEKILEAQERLNQPSNINMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPTE-- 1537

  Fly  1288 SLRSLNERLQRELEDLKHKSAGAESNMQQEIEELQANNQQMAERINELE-------TLRAGIQA- 1344
              ..:|:.::|:.|:|           ::|.||      ::.|||..:|       .||..::| 
Yeast  1538 --EKINKIIERKKEEL-----------EKEFEE------KVEERIKSMEQSGEIDVVLRKQLEAK 1583

  Fly  1345 ----QQLLASMAPKNVQEA---------AAAGE----KAELESKLKEIMNEVQDVTNRNLFLEQK 1392
                |:.|.:...|.:||.         .:..|    :||:||:|:|..|.......:..|.|.|
Yeast  1584 VQEKQKELENEYNKKLQEELKDVPHSSHISDDERDKLRAEIESRLREEFNNELQAIKKKSFDEGK 1648

  Fly  1393 CENFL---ILEQSNERLKLQNAKLSRQLDETLVSMQHSEAVPANT------------EFEYLRNI 1442
            .:..:   :||:     ||  ||:..||.||   .|.:|:.|.:.            :.|...|.
Yeast  1649 QQAMMKTTLLER-----KL--AKMESQLSET---KQSAESPPKSVNNVQNPLLGLPRKIEENSNS 1703

  Fly  1443 MFQYLTGNTNNETLVKVIS-----AVLKFSPQQAQVALEKEHQRR-SLLNK 1487
            .|..|   .:.|.|:|:.|     ....|:.......|:.::.:| ||.||
Yeast  1704 PFNPL---LSGEKLLKLNSKSSSGGFNPFTSPSPNKHLQNDNDKRESLANK 1751

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Golgin245NP_611787.2 Smc 286..1089 CDD:224117 221/1102 (20%)
Phage_GPO <306..421 CDD:301727 33/143 (23%)
Smc 737..1442 CDD:224117 180/862 (21%)
MIT_CorA-like <1244..>1333 CDD:294313 18/92 (20%)
Grip 1433..1477 CDD:197860 10/61 (16%)
MLP1NP_013021.1 Smc 214..1087 CDD:224117 174/899 (19%)
TPR_MLP1_2 999..1125 CDD:285204 24/133 (18%)
eIF-4B <1396..1475 CDD:283846 21/99 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126585
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.