DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Golgin245 and USO1

Sequence 1:NP_611787.2 Gene:Golgin245 FlyBaseID:FBgn0034854 Length:1489 Species:Drosophila melanogaster
Sequence 2:NP_010225.1 Gene:USO1 SGDID:S000002216 Length:1790 Species:Saccharomyces cerevisiae

Alignment Length:1522 Identity:336/1523 (22%)
Similarity:641/1523 (42%) Gaps:377/1523 (25%)


  Fly    25 NAAQAAVSSSSSTTPNSETNTSNNE----------NFFSI-TEEDTPQN-SPYRI---------- 67
            ||.:...|:.|....:|:.:|...:          |.|.: ...|...| :|:::          
Yeast   458 NAKENGGSNKSDKESDSDKDTDGKDGTEYEGSFKANLFEVLLNYDAELNLNPFKLFFTTDIFMFF 522

  Fly    68 --------QKLPATSASALRGRSTQS---LNGATSRTRKLSNSSMASDVSFRLP-TYEAPAVYHL 120
                    ::|...:.:...|...:.   |....:.:..|:.|..|:|:  |:| :|....:|.|
Yeast   523 FQQDHKYSEELREITRNVTTGNDLEDEEPLKAIQTISELLTTSLTAADI--RIPISYLTFLIYWL 585

  Fly   121 QSDLDETSSEFDDSASTARLDVITKDQLYDAYKKSLDRYHKYRCRYTD-LAKKYKELERDSSKAR 184
            ..|...|:....|.:       :.|..|..:|:.. |.....:|..|. |...|:...::|...|
Yeast   586 FGDFKATNDFLSDKS-------VIKSLLSFSYQIQ-DEDVTIKCLVTMLLGVAYEFSSKESPFPR 642

  Fly   185 SVLVETQDKAL------RRISELREQCTLEQQAKAHLEE--ALRVEMDDMSCKMQAYQTK-LQLL 240
            ....|...|.|      .||.:.::....   :|..:.|  .|..|:|:.......:.|. :||.
Yeast   643 KEYFEFITKTLGKDNYASRIKQFKKDSYF---SKVDMNEDSILTPELDETGLPKVYFSTYFIQLF 704

  Fly   241 GENPENITAAL-----ERSGQQLESEQLIDLEESIGK-----SPLSTNGSSGVSDLQRLL----- 290
            .||...|..||     |....::..|::..|:....|     :.|.|...|...:|...|     
Yeast   705 NENIYRIRTALSHDPDEEPINKISFEEVEKLQRQCTKLKGEITSLQTETESTHENLTEKLIALTN 769

  Fly   291 --KERDE---------------------QLKSV-------TEKYEAVRKQEEENVLLLAQTKQAI 325
              ||.||                     :||:|       |:..:.:..:::||...|.:.|..|
Yeast   770 EHKELDEKYQILNSSHSSLKENFSILETELKNVRDSLDEMTQLRDVLETKDKENQTALLEYKSTI 834

  Fly   326 HTELELKDTEVRKLQEKLKQLESQRESHNNEVKEQFKKLQATKQEVDAKLMATEHLLNTLKESYA 390
            |.:    :..::.|::.|:.:.||::...:.:.:..|.|.|..:|:.|   ..|:..|..||   
Yeast   835 HKQ----EDSIKTLEKGLETILSQKKKAEDGINKMGKDLFALSREMQA---VEENCKNLQKE--- 889

  Fly   391 IKEQQVVTLEAQLEAIRVENEQKVKDLQKQN---EDRNTQASDSSEQLKKLQAAVQDAESQLLSK 452
             |::..|..:.:.::::.:...|:.:::..|   |:...|.::.|::.:.:...:.:.:|:..|.
Yeast   890 -KDKSNVNHQKETKSLKEDIAAKITEIKAINENLEEMKIQCNNLSKEKEHISKELVEYKSRFQSH 953

  Fly   453 DQLLESLRSEQAAKEQQLKHLKEQLGKLKQENENYLDKLRENKKSS-----------DSQTNEAQ 506
            |.|:..|       .::||.|......::.|||:.:..:.|:|..|           ||.:.|.:
Yeast   954 DNLVAKL-------TEKLKSLANNYKDMQAENESLIKAVEESKNESSIQLSNLQNKIDSMSQEKE 1011

  Fly   507 -------------DQQKK----LQAAKDEAESKLLATEELLHSLRNDYKAQEEKVALLEDKLKTL 554
                         :|.||    |:..|:|..||       ..|.:::|::|   ::||::||:|.
Yeast  1012 NFQIERGSIEKNIEQLKKTISDLEQTKEEIISK-------SDSSKDEYESQ---ISLLKEKLETA 1066

  Fly   555 SKENDVNVEKLHHINEQREAQSTDSQQKINELRAAKDEAEAKLLSTEHSLNALQAALSAKEEQAA 619
            :..||.||.|:..:.:.||    :.:.::...:..|:|.|.||.::|.:|..::......:|:..
Yeast  1067 TTANDENVNKISELTKTRE----ELEAELAAYKNLKNELETKLETSEKALKEVKENEEHLKEEKI 1127

  Fly   620 SLEQSLNALKTESEHSLQDLRLHNDQLLEIVQRHQQNDWEAQLARAREELAAIQSQRELHALELE 684
            .||:.    .||::..|..||.:    ||.::: :..|..|||.:..|::|  ..:|:.:     
Yeast  1128 QLEKE----ATETKQQLNSLRAN----LESLEK-EHEDLAAQLKKYEEQIA--NKERQYN----- 1176

  Fly   685 KSLEMERESVAALNSEKASQEEQH---RLKLEQLQREIQILQ---DQHANSESETVAALKGQLEA 743
                   |.::.||.|..|.::::   :.|.::|:.|::.::   ::.:|.:...:.||..|::.
Yeast  1177 -------EEISQLNDEITSTQQENESIKKKNDELEGEVKAMKSTSEEQSNLKKSEIDALNLQIKE 1234

  Fly   744 LSQDLATSQASLLAKEKELKASGNKLNKIKKQHEQHQAKSSDQSARLEALQSELADRLSHSRQVE 808
            |.:...|::||||...|.:::...|:.:::.:....:.:.|:...:|:|.:.:.:..|...::.|
Yeast  1235 LKKKNETNEASLLESIKSVESETVKIKELQDECNFKEKEVSELEDKLKASEDKNSKYLELQKESE 1299

  Fly   809 SEKEELQARVTGI---LEEIGTMQAQMQQVQDSHSELER-------EKRKLESRIESLQQE-QVD 862
            ..||||.|:.|.:   ||:|..:....::   |.|||.|       |::..|.::|.|:.| |:.
Yeast  1300 KIKEELDAKTTELKIQLEKITNLSKAKEK---SESELSRLKKTSSEERKNAEEQLEKLKNEIQIK 1361

  Fly   863 SSAQDERTSAKLEEIQSENTKLAERNCLLEEQTNHLESQLQAKQDEIGKIQAKLQQVLDEHSKLQ 927
            :.|.::......|...:...:.:|:...||::...|:::.:.|..||...:::|::|     .|.
Yeast  1362 NQAFEKERKLLNEGSSTITQEYSEKINTLEDELIRLQNENELKAKEIDNTRSELEKV-----SLS 1421

  Fly   928 NAQELMDHDHRT---LQDKCDAYEKDKLLTKHTLDCLQSASEELHRVKANLDRELKEQDQQLSEL 989
            | .||::....|   |||:..:| ||| :|::        .|:|..::.:..|:|:...:||...
Yeast  1422 N-DELLEEKQNTIKSLQDEILSY-KDK-ITRN--------DEKLLSIERDNKRDLESLKEQLRAA 1475

  Fly   990 RERQREQEQQLKDQAERCAKLKAQ---NSESETQLQATISNLREQLDAYKQTEQGIQEKLQATNS 1051
            :|.:.:.|:.||...|..:|.||:   :.|...:|::||.:...:|.:..:|.:...|||:.:..
Yeast  1476 QESKAKVEEGLKKLEEESSKEKAELEKSKEMMKKLESTIESNETELKSSMETIRKSDEKLEQSKK 1540

  Fly  1052 SYTTQIATLEARWSAANSDVERL-HEANDAL------QLEMEQLK------IKHGQEREEVKESI 1103
            |              |..|::.| ||.:|.:      :.::|:||      .|.|.|.|.||:  
Yeast  1541 S--------------AEEDIKNLQHEKSDLISRINESEKDIEELKSKLRIEAKSGSELETVKQ-- 1589

  Fly  1104 AQKNRQVVELQEAMATRDRQLQEKIEASEKLAKFDEILIENEYLNKHTKQLEAELAE-SAELK-- 1165
                    ||..|        ||||..:.:         ||..|....:.:|.||.: .||:|  
Yeast  1590 --------ELNNA--------QEKIRINAE---------ENTVLKSKLEDIERELKDKQAEIKSN 1629

  Fly  1166 --------EKLKSLQCELYVLQEKAEQHAVQMAEKETQSATATAEVSELKKAIEEQAVELTRQKE 1222
                    .:||.|:.||...|:||     |.:|:|.::.....:|.  |..::|:|:.|.    
Yeast  1630 QEEKELLTSRLKELEQELDSTQQKA-----QKSEEERRAEVRKFQVE--KSQLDEKAMLLE---- 1683

  Fly  1223 HASFVTEQSDAVQKDLLQAQQQLHDKQIELAMSRDEQALLQAEADGLRQEVICLKEHLSPSTDSD 1287
                 |:.:|.|.|              |.|..|||.. ::...|..|||:              
Yeast  1684 -----TKYNDLVNK--------------EQAWKRDEDT-VKKTTDSQRQEI-------------- 1714

  Fly  1288 SLRSLNERLQRELEDLKHKSAGAESNMQQEIEELQANNQQMAERINELETLRAGIQAQQLLASMA 1352
                  |:|.:||::||     ||::..:|..|         :| :|::.|      ..|:..:.
Yeast  1715 ------EKLAKELDNLK-----AENSKLKEANE---------DR-SEIDDL------MLLVTDLD 1752

  Fly  1353 PKNVQEAAAAGEKAELESKLKEIMNEV 1379
            .||          |:..||||::..|:
Yeast  1753 EKN----------AKYRSKLKDLGVEI 1769

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Golgin245NP_611787.2 Smc 286..1089 CDD:224117 201/899 (22%)
Phage_GPO <306..421 CDD:301727 22/115 (19%)
Smc 737..1442 CDD:224117 165/685 (24%)
MIT_CorA-like <1244..>1333 CDD:294313 20/89 (22%)
Grip 1433..1477 CDD:197860
USO1NP_010225.1 Uso1_p115_head 367..715 CDD:282693 53/270 (20%)
Mplasa_alph_rch 830..1569 CDD:275316 187/827 (23%)
SPEC 1025..1216 CDD:295325 55/228 (24%)
TMPIT 1271..>1371 CDD:285135 26/103 (25%)
LCD1 1318..>1434 CDD:286837 28/125 (22%)
CENP-F_leu_zip 1536..1677 CDD:287450 45/189 (24%)
Uso1_p115_C 1654..1771 CDD:282695 44/199 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126585
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.