DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Golgin245 and AT2G32240

Sequence 1:NP_611787.2 Gene:Golgin245 FlyBaseID:FBgn0034854 Length:1489 Species:Drosophila melanogaster
Sequence 2:NP_565741.4 Gene:AT2G32240 AraportID:AT2G32240 Length:1333 Species:Arabidopsis thaliana

Alignment Length:1454 Identity:352/1455 (24%)
Similarity:608/1455 (42%) Gaps:368/1455 (25%)


  Fly   127 TSSEFD------DSASTARLDV------ITKDQLYDAYKKSLDRYHKYRCRYTDLAKKYKELERD 179
            ||||..      |...||.:.|      :.|::     |:..|.      .:..:.|:..:.:.|
plant     8 TSSEVPVVKGDVDDLKTADISVKAVNGEVPKEE-----KEEEDG------EFIKVEKEAFDAKDD 61

  Fly   180 SSKARSVLVETQDKALRRISELREQCTLEQQAKAHLEEALRVEMDDMSCKMQAYQT-----KLQL 239
            :.||..|.||.|.:.:.|.|...::...|.|.||   :.|.:|::.::.:::.|::     |.:|
plant    62 AEKADHVPVEEQKEVIERSSSGSQRELHESQEKA---KELELELERVAGELKRYESENTHLKDEL 123

  Fly   240 LGENPENITAALERSG-----QQLESEQLIDLEESIGKSPLSTNGSSGVSDLQRLLKERDEQLKS 299
            |... |.:....::.|     |:.:.|::::.||         ..||.:..|:..|:..|.:.|.
plant   124 LSAK-EKLEETEKKHGDLEVVQKKQQEKIVEGEE---------RHSSQLKSLEDALQSHDAKDKE 178

  Fly   300 VTEKYEAVRKQEEENVLLLAQTKQAIHTELELKDTEVRKLQEKLKQLESQRESHNNEVKEQFKKL 364
            :||..||.               .|:..|||....::.:|:|.||     |.:...:..|:..|.
plant   179 LTEVKEAF---------------DALGIELESSRKKLIELEEGLK-----RSAEEAQKFEELHKQ 223

  Fly   365 QATKQEVDA-KLMATEHLLNTLKESYAIKEQQVVTLEAQLEAIRVENEQKVKDL-QKQNEDRNTQ 427
            .|:..:.:: |.:....||.:.|||....|:::.:|           :|::|:| :|.:|:...:
plant   224 SASHADSESQKALEFSELLKSTKESAKEMEEKMASL-----------QQEIKELNEKMSENEKVE 277

  Fly   428 AS--DSSEQLKKLQAAVQDAESQLLSKDQLLESLRSEQAAKEQQLKHLKEQLGKLKQENENYLDK 490
            |:  .|:.:|    ||||  |...|||.:|||:        ||::...:..:.:|.||       
plant   278 AALKSSAGEL----AAVQ--EELALSKSRLLET--------EQKVSSTEALIDELTQE------- 321

  Fly   491 LRENKKSSDSQTNE----AQD---QQKKLQAAKDEAE---SKL---LATEELLHSLRNDYKAQEE 542
             .|.||:|:|:..|    .||   |.|.|||...|.|   |||   |..:|||.||..|   |||
plant   322 -LEQKKASESRFKEELSVLQDLDAQTKGLQAKLSEQEGINSKLAEELKEKELLESLSKD---QEE 382

  Fly   543 KVALLEDKLKTLSKENDVNVEKLHHINEQREAQSTDSQQKINELRAAKDEAEAKLLSTEHSLNAL 607
            |:....:||..:.||           .|..||...:....:..:....:|.|.||.:::.:.:..
plant   383 KLRTANEKLAEVLKE-----------KEALEANVAEVTSNVATVTEVCNELEEKLKTSDENFSKT 436

  Fly   608 QAALSAKEEQAASLEQSLNALK-------------TESEHSLQDLRLHNDQLLEIVQRHQQNDWE 659
            .|.||......:.|||.|.:|:             |:....|:|:...:.|..| ..:.|..:.|
plant   437 DALLSQALSNNSELEQKLKSLEELHSEAGSAAAAATQKNLELEDVVRSSSQAAE-EAKSQIKELE 500

  Fly   660 AQLARAREELAAIQSQRELHALELEKSLEMERESVAALNSEKASQ--------EEQHRLKLEQLQ 716
            .:...|.::.|.::.|  |:.|:| ||.:.|||....  |||:|:        ||:.:....|:|
plant   501 TKFTAAEQKNAELEQQ--LNLLQL-KSSDAERELKEL--SEKSSELQTAIEVAEEEKKQATTQMQ 560

  Fly   717 R--------EIQILQDQHANSESETVAALKGQLEALSQDLA--TSQASLLAKEKELKASGNKLNK 771
            .        |:.:.|....|||.|....:..|..|..:|.|  |.|.|:               :
plant   561 EYKQKASELELSLTQSSARNSELEEDLRIALQKGAEHEDRANTTHQRSI---------------E 610

  Fly   772 IKKQHEQHQAKSSDQSARLEALQ----------SELADRLSHSRQVESEKEELQARVTGILEEIG 826
            ::...:..|:|..|...||:.|:          .||.:::|   .:|.:..|.:|...|.|.::.
plant   611 LEGLCQSSQSKHEDAEGRLKDLELLLQTEKYRIQELEEQVS---SLEKKHGETEADSKGYLGQVA 672

  Fly   827 TMQAQMQQVQDSHSELE-------REKRKLESRIESLQQEQVDSSAQDERTSAKLEEIQSENTKL 884
            .:|:.::..|...|.||       ..:::|...:.::..|:....|..:..|.|:.|  |||   
plant   673 ELQSTLEAFQVKSSSLEAALNIATENEKELTENLNAVTSEKKKLEATVDEYSVKISE--SEN--- 732

  Fly   885 AERNCLLEEQTNHL---ESQLQAKQDEIGKIQAKLQQVLDEHSKLQNAQELMDHDHRTLQDKCDA 946
                 |||...|.|   :.:|::.::::.....:..:|::   ||::|:|.::...|        
plant   733 -----LLESIRNELNVTQGKLESIENDLKAAGLQESEVME---KLKSAEESLEQKGR-------- 781

  Fly   947 YEKDKLLTKH-TLDCL-QSAS-EELHRVKANLDRELKEQDQQLSELRERQREQEQQLKDQAERCA 1008
             |.|:..||. .|:.| ||.| :..||::..:: |...:|.:.|.|.|:.|:.|.::|...|:.|
plant   782 -EIDEATTKRMELEALHQSLSIDSEHRLQKAME-EFTSRDSEASSLTEKLRDLEGKIKSYEEQLA 844

  Fly  1009 KLKAQNSESETQLQATISNLREQLDAYKQTEQGIQEKL-----QATNSSYTTQIATLEARWSAAN 1068
            :...::|..:.:|:.|:..|        ...:.:.|||     ||...|.            .::
plant   845 EASGKSSSLKEKLEQTLGRL--------AAAESVNEKLKQEFDQAQEKSL------------QSS 889

  Fly  1069 SDVERLHEANDALQLEMEQLK--IKHG--------QEREEVKESIAQKNRQVVELQEAMATRDRQ 1123
            |:.|.|.|.|:.|::::::|:  |..|        :..||..|...||..:..:|.|.:.|.:.|
plant   890 SESELLAETNNQLKIKIQELEGLIGSGSVEKETALKRLEEAIERFNQKETESSDLVEKLKTHENQ 954

  Fly  1124 LQE---------------KIEASEKLAKFDEILIENEYLNKHTKQLEAELAESAELKEKL----- 1168
            ::|               |:|..:.|:|...:....|.|....:.||.|..:.||:..||     
plant   955 IEEYKKLAHEASGVADTRKVELEDALSKLKNLESTIEELGAKCQGLEKESGDLAEVNLKLNLELA 1019

  Fly  1169 ------KSLQCELYVLQEKAEQHAVQMAEKETQSATATAEVSELKKAIEEQAVELTRQKEHASFV 1227
                  ..||.:|..|:          |||| |:|.   |:...|..||:...:||.:.|.    
plant  1020 NHGSEANELQTKLSALE----------AEKE-QTAN---ELEASKTTIEDLTKQLTSEGEK---- 1066

  Fly  1228 TEQSDAVQKDLLQAQQQLHDKQIELAMSRDEQALLQAEADGLRQEVICLKEHLS-PSTDSDSLRS 1291
                       ||:|...|.::     :....|:.|:..:.|:..:..|:|.|: .|:.:|:|.|
plant  1067 -----------LQSQISSHTEE-----NNQVNAMFQSTKEELQSVIAKLEEQLTVESSKADTLVS 1115

  Fly  1292 LNERLQRELEDLKHKSAGAESNMQQEIEELQANNQQMAERINELETLRAGIQAQQLLASMAPKNV 1356
                   |:|.|: ..|..:|.::...|||:....::..::.|                    ||
plant  1116 -------EIEKLR-AVAAEKSVLESHFEELEKTLSEVKAQLKE--------------------NV 1152

  Fly  1357 QEAAAAGEK-AELESKLKE---IMNEVQDVTNRNLFLEQKCENFLILEQSNERLKLQNAKLSRQL 1417
            :.||.|..| |||.|||:|   |..| :||.|..:...||  .....:.|.:..|..:::...:|
plant  1153 ENAATASVKVAELTSKLQEHEHIAGE-RDVLNEQVLQLQK--ELQAAQSSIDEQKQAHSQKQSEL 1214

  Fly  1418 DETLVSMQHSEAVPAN----TEFE 1437
            :..|...|  |.:.|.    ||||
plant  1215 ESALKKSQ--EEIEAKKKAVTEFE 1236

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Golgin245NP_611787.2 Smc 286..1089 CDD:224117 217/879 (25%)
Phage_GPO <306..421 CDD:301727 25/117 (21%)
Smc 737..1442 CDD:224117 181/777 (23%)
MIT_CorA-like <1244..>1333 CDD:294313 19/90 (21%)
Grip 1433..1477 CDD:197860 4/10 (40%)
AT2G32240NP_565741.4 SMC_prok_B <85..838 CDD:274008 216/880 (25%)
Smc 623..>1259 CDD:224117 172/728 (24%)
mycoplas_twoTM 1039..>1155 CDD:275320 36/168 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126585
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.