DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Golgin245 and golga4

Sequence 1:NP_611787.2 Gene:Golgin245 FlyBaseID:FBgn0034854 Length:1489 Species:Drosophila melanogaster
Sequence 2:XP_005157128.1 Gene:golga4 ZFINID:ZDB-GENE-050208-275 Length:2175 Species:Danio rerio

Alignment Length:2230 Identity:490/2231 (22%)
Similarity:835/2231 (37%) Gaps:810/2231 (36%)


  Fly     1 MFANLKNKLIEE---------------------------VKASP----------------SKFQQ 22
            ||..||.|:|:|                           ..:||                |::..
Zfish     1 MFKKLKQKVIDEQSPQRSSAQPQVSSGERRPQPPLLHQDAPSSPNDRELLAGMIAEPAFLSEYTI 65

  Fly    23 FA-------NAAQAAVSSSSSTTPNSETNTSNNENFFSITEEDTPQNSPYRIQKLPATSASALRG 80
            ||       .|||  |.|:|.....|....|.|.:..:..:.:..|:...::|:..::..|.|||
Zfish    66 FALDHSKRPKAAQ--VPSASVKAAGSSPRGSVNGDGVASPQREESQSLAQKLQQKVSSVESLLRG 128

  Fly    81 RS-TQSLNGATSR---TRKLSNSSMASDVSFRLPTYEAPAVYHLQSDLDETSSEFDDSASTARLD 141
            .. ::.|..:.||   .|..|..|:........|.|:.|      ||::   ||.:||..:  ::
Zfish   129 SGRSEGLFRSGSRDSLIRSSSRESLTQTGENEAPAYDPP------SDIE---SEAEDSPGS--VE 182

  Fly   142 VITKDQLYDAYKKSLDRYHK-------YRCRYTDLAKKYKELERDSSKARSVLVETQDKALRRIS 199
            .::::||       |.|.|:       ||.:|::|...|:..:||..|.:::|.::||||||||.
Zfish   183 SLSREQL-------LHRLHRVERSLGNYRGKYSELVTAYRTAQRDKEKTQAILSQSQDKALRRIG 240

  Fly   200 ELREQCTLEQQAKAHLEEALRVEMDDMSCKMQAYQTKLQLLGENPENITAALERSGQQLESE--- 261
            ||||:..::||||.||:|.....:::....:....|::.||.:.       |:.||..|.||   
Zfish   241 ELREELQMDQQAKKHLQEEFDAALEEKDQMITVLHTQVSLLKKR-------LQASGGVLSSELQV 298

  Fly   262 ----QLIDLEESI------GKSPLSTNGS--SG----VSDLQ-----------------RLLKER 293
                ..:|....:      ..|.|:|.||  ||    |..||                 |..|||
Zfish   299 SPATDTVDANSDVQSPSKDDNSTLNTEGSVDSGSAVDVESLQKRVTRQESLLQRCKEMIRSSKER 363

  Fly   294 DEQLKS-----------------------VTEKYE----------AVRKQEEENVLLLAQTKQAI 325
            ..||.|                       .|||.:          .:.:.|::..:::|:||:.:
Zfish   364 SAQLSSESEVLQQQLQERLQELEKMKELHTTEKTKLITQLGDAKNLIEQLEQDKGMVIAETKRQM 428

  Fly   326 HTELELKDTEVRKLQEKLKQ-------LESQRESHNN-------------------------EVK 358
            |..||:|:.|:.:|:.:|:|       |:.|:|....                         .::
Zfish   429 HETLEMKEEEIAQLRSRLQQSITQKDELQEQKEKSEKAAFEELERALGVAQRAEEARRQLQLSME 493

  Fly   359 EQFKKLQAT---------------------------------------------KQEVDAKL-MA 377
            ||.|:::..                                             :||:.|:: :|
Zfish   494 EQVKQVETASEEERRSLQQELTRVKQEVVTIMKKSSEDRITEMERLHSEAIARKEQEMSAQIKLA 558

  Fly   378 TEHLLNTLKESYAIKEQQ--VVTLEAQLE--AIRVENEQKVKDLQKQNEDRNTQASD------SS 432
            .|.....|.:|...:|||  :...||:|:  |::.|.|.|.|:||.:.|...|:..:      |.
Zfish   559 VEQCREELLQSAQEREQQASLALEEAELQKAAVQSEGENKAKELQLELESARTRIQELESCLGSP 623

  Fly   433 EQLKKL------QAAVQDAE--------------------------------------------- 446
            |:|.:|      |..:.:||                                             
Zfish   624 EKLDELGTQIEEQRKIHEAEIATLGETHKQELESKVSEQITALRQEHDVAMEELIHKHKAEIESI 688

  Fly   447 -------------------------------------SQLL-SKDQLLESLRS------------ 461
                                                 |:|| ||.||.:.|.|            
Zfish   689 LKDKEEQFHSHVEDMNKKILDKLSDKQTELETVSAELSELLNSKQQLEDRLSSVEATSETLRQEF 753

  Fly   462 EQAAKEQQLKH--------------------LKEQLGKLK---QENENYLDK--LRE-------- 493
            |:..|::|.||                    |||::..||   :|.|..|::  |||        
Zfish   754 EERIKKEQAKHQAEIEAANKNEQSFAGVEKMLKEEINHLKIALEEKEKVLEEHVLREKSLLEDGS 818

  Fly   494 ------------NKKSSDSQTNEAQDQQKKLQAAKDEAESKLLATEELLHSLRNDYKAQE----- 541
                        ||::.:...::......:||.|:|:.::    .||.|.::|||.|.:|     
Zfish   819 AQLEELWLRAQLNKEALEESRSQVSTLTDELQQARDQVKN----LEETLEAVRNDCKEKEVCLEE 879

  Fly   542 ------EKVALLEDKLKTLSKENDVNV-------EKLHHINEQREAQSTDSQQKINELRAAKDEA 593
                  |.|..:|...|.||::.:::.       |:.:.:.:|.:.|.:..::|:..:|  || .
Zfish   880 KTNELQELVQKIEHIKKDLSEKENLHAATCKTLQEEQNRLRKQLDDQKSSQEKKLENIR--KD-M 941

  Fly   594 EAKLLSTEHSLNAL-QAALSAKEEQAASLEQSLNALKTESEHSLQDLRLHNDQL----LEIVQ-- 651
            :.||.|.|:.|... |.|..|:::....|:....:.|.|....:|:|.|.:.||    ||:.|  
Zfish   942 DCKLKSQENKLEKFKQKAKEAQDKMKKKLQDQEESAKVELSKKIQELELKDQQLKEKILEMAQTS 1006

  Fly   652 ------------------------RHQQ------NDWEAQLARAREELAAIQSQRELHALELEKS 686
                                    .|:|      ..|:.:|.:..||:      :|.|:..|:..
Zfish  1007 SEGLSTAMSDLEANHKEHLDKLQVNHKQELEDLVRHWQEKLNQNEEEM------QEKHSQTLQDK 1065

  Fly   687 LEMERESVAALNSEKASQEEQ-----HRLKLEQLQRE--IQILQDQ--HANSESETVA----ALK 738
            .: |.|.::.|.|....:.||     ..|:.|...||  :|.||.:  .|.|:.||::    .||
Zfish  1066 AQ-ELEEISRLLSSSKEENEQIIKDIQNLREELAMRETTVQKLQTELREAASKLETLSEGEGMLK 1129

  Fly   739 GQLEALSQDL--ATSQASLLAKE--KELKASGNKLNKIKKQHEQHQAKSS----DQSARLEALQS 795
            .|:|.:.::|  |.::.:||..|  |..:.|..||..|.::....|.|.|    .:....|.||.
Zfish  1130 RQVETMEKNLNQALNERNLLQDELRKVEETSKEKLQAISEELVNTQQKISLLETSKCKEGEHLQR 1194

  Fly   796 ELADRLSHSRQVESE---------------KEELQARVTG--------ILEEIGTMQAQMQQVQD 837
            .||::.:..:..|.|               .:|.||::.|        :.|.:|.:|.::...|:
Zfish  1195 TLAEKTAELQNKEKEFQAQLCSLTMEFKQCCQEAQAKIDGFSVELCKKVDERVGALQLRVIDHQN 1259

  Fly   838 SHSELEREKRKLESRIESLQQE---QVD-----SSAQDERT------SAKLEEIQSENTKL---A 885
            ..:.|....:..::||.:|::|   .:|     .|:.||.|      |..|:.:|:|...|   |
Zfish  1260 KVAYLRNIIKTKDNRISTLEKELQHTLDVNHNLKSSLDEITLQFGESSETLKALQTERESLQTDA 1324

  Fly   886 E-RNCLLEEQTNHLESQLQAKQDEIGKIQAKLQQVLD--------------------EHSKLQNA 929
            | |..:|.|:..|::...:.||:....::|.:.|:.|                    |...|.|.
Zfish  1325 ESRFQVLSEKDLHIKQLCEEKQNVSENLKANILQISDLESAINDLKTQLASSITEKEEAISLLNQ 1389

  Fly   930 QELMDHDHRTLQ--DKCDAYEKDKLLTKHTLDCLQSASEELHR--------VK------ANLDRE 978
            |...|.:..|.|  :..:..||:|.|.:..:|.|::...||.:        ||      |:::|:
Zfish  1390 QHSKDKERVTSQMGETVEKLEKEKTLLQEQVDSLRNKFSELKKKFSQSHSTVKSLQDKLADMERQ 1454

  Fly   979 LKEQDQQL--------------SELRERQREQEQQ---LKDQAERCAKLKAQNSESETQLQATIS 1026
            :.|:|.||              ||:.:...|::|:   |..:.|.|:|   :..:.|.|||..:.
Zfish  1455 IAEKDGQLQTLTASVDNHSISKSEMDQALSEKDQRVHALTSELESCSK---KVCDLEEQLQLRVK 1516

  Fly  1027 NLREQLDAYKQTEQGIQEKLQATNSSYTTQIATLEARWSAANSDVERLHEANDALQLEMEQLKIK 1091
            . |:||.|..|....|:|   :..:....|:...:.:.|...:.:::..|:..:|:.::|..|.:
Zfish  1517 E-RDQLAADLQQHHNIRE---SEKTELMKQVQEAQDQSSQNGALMQKTEESLQSLRKDIESAKQE 1577

  Fly  1092 HGQER---EEVKESIAQKNRQVVELQEAMATRD--------------------RQLQEKIEASEK 1133
            ...:|   |..|..|.::.::.|:..:..|:.:                    :||..:||..|:
Zfish  1578 LESQRKDFEREKAEILKEKKEAVKAAQVKASSETGVKVAELKKKAEQKIGMIRKQLTSQIEEKEQ 1642

  Fly  1134 LAK--------FDEILIENEYLNKHTKQLEAELAESA------------ELKEK--------LKS 1170
            :.|        ..:..||.|   :|.|.||..:.|:.            ||:||        |::
Zfish  1643 VIKDLHVQLETIKQSQIEKE---EHIKSLEKTMQETTAKLNEDHAKHLQELQEKEKDERLTSLQN 1704

  Fly  1171 LQCELYVLQEK----------AEQHA---------------VQMAEKETQSATATAEVSELKKAI 1210
            || |:|  :||          .|:|:               .:::|...|.|....|||.||:.:
Zfish  1705 LQ-EMY--EEKLACLHKDISAKEEHSAAAARETSSRLVDLETKLSESNEQIANYQNEVSRLKEDL 1766

  Fly  1211 EEQAV----------------------ELTRQ---------------------KEHASFVTEQSD 1232
            .||..                      |:.|:                     ||:...|..|.|
Zfish  1767 IEQTSRVQELQQTCSDLREQIKQKQIDEVEREQVCEVQINSNRLGMEPAMLVAKENMDTVGNQDD 1831

  Fly  1233 ----------AVQKDLLQAQQQLHDKQIELAMSR---------DEQALLQ-------------AE 1265
                      ..::.||..||:|.||:.||...:         |.:.|:.             .|
Zfish  1832 WLSQKNLLVKEYEEKLLDLQQRLEDKENELKAQQSSPQRNGESDGECLINNTNTSENDLQRKLVE 1896

  Fly  1266 ADGLRQEVICLKEHLSPSTDSDSLRSLNERLQRELEDLKHKSAGA-ESNMQQEIEELQAN----- 1324
            |:..:|::     |...|.....||||.:..::|||.||.:.|.. |..::.|:|:::..     
Zfish  1897 AENEKQKI-----HKDYSRLQKDLRSLRKEHEKELEFLKKEMAEENEKKLKLEMEDMEMKHNSAL 1956

  Fly  1325 -------NQQMAERINELE-TLRAGI-------------------QAQQLLASMAP---KNVQ-- 1357
                   |.|||.:..||| :::..|                   |.|::::....   :.||  
Zfish  1957 KQLMREFNTQMALKEKELEGSVKETIEKAQCVETELIESHRDEVSQLQKIISQKEEDLNRTVQRY 2021

  Fly  1358 EAAAAGEKAELESKLKEIMNEVQDVTNRNLFLEQKCENFLILEQSNERLKLQNAKLSRQ------ 1416
            |......:.|:..::.|:..|::::..|:|...|..:. |.:..:.:...|..|||..|      
Zfish  2022 EQVLQSREVEMGDRVWEVQKELEELQQRSLSGPQGLDE-LKVHLAEKTTMLSEAKLKEQEYHDRI 2085

  Fly  1417 ------------------LDETLVSMQHSEAVPAN--TEFEYLRNIMFQYLTGNTNNETLVKVIS 1461
                              |..|...|.|:.|.|.:  |||||||.:||:|:.|. ..:|:.|||:
Zfish  2086 HALEDKLRRVHKNAVVTHLGSTYKDMSHNSADPFSEPTEFEYLRKVMFEYMMGR-ETKTMAKVIT 2149

  Fly  1462 AVLKFSPQQAQVALEKEHQR 1481
            ::|||...|||..||:|..|
Zfish  2150 SMLKFPADQAQKVLEREDSR 2169

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Golgin245NP_611787.2 Smc 286..1089 CDD:224117 261/1257 (21%)
Phage_GPO <306..421 CDD:301727 38/197 (19%)
Smc 737..1442 CDD:224117 223/1022 (22%)
MIT_CorA-like <1244..>1333 CDD:294313 29/124 (23%)
Grip 1433..1477 CDD:197860 23/46 (50%)
golga4XP_005157128.1 Smc 430..1281 CDD:224117 175/865 (20%)
P-loop_NTPase <649..>790 CDD:304359 17/141 (12%)
eIF-4B <869..961 CDD:283846 23/95 (24%)
DUF342 <920..1006 CDD:302792 25/89 (28%)
Mplasa_alph_rch 934..1676 CDD:275316 174/762 (23%)
iSH2_PI3K_IA_R 1045..>1177 CDD:304922 38/139 (27%)
Smc 1338..>2095 CDD:224117 157/776 (20%)
GRIP 2122..2165 CDD:295740 23/44 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C353876946
eggNOG 1 0.900 E1_28M43
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 266 1.000 Inparanoid score I2972
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005529
OrthoInspector 1 1.000 T1054598
orthoMCL 1 0.900 OOG5_126585
Panther 1 1.100 LDO PTHR19327
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5799
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.880

Return to query results.
Submit another query.