DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Golgin245 and cmet

Sequence 1:NP_611787.2 Gene:Golgin245 FlyBaseID:FBgn0034854 Length:1489 Species:Drosophila melanogaster
Sequence 2:NP_524993.3 Gene:cmet FlyBaseID:FBgn0040232 Length:2189 Species:Drosophila melanogaster

Alignment Length:1721 Identity:366/1722 (21%)
Similarity:701/1722 (41%) Gaps:439/1722 (25%)


  Fly   120 LQSDLDETSSEFDDSASTARLDVITKDQLYDA----YKKSLDRYHKYRCRYTDLAKKYK------ 174
            |..:.|...:.:.||..|..|........:.:    .|.|:....:....:...|||.:      
  Fly   264 LSENADNRFTNYRDSKLTRILQASLGGNAFTSIICTIKPSIMEESQSTLSFATRAKKIRIKPQVN 328

  Fly   175 ELERDSSKARSVLVETQDKALR-RISELREQCTLEQQAKAHLEEALRVEMDDMSCKMQAYQTKLQ 238
            |:..|::..:.  :|.:.|.|: :::| .|:....||...|||..::.:|..:.|     ...|.
  Fly   329 EMVSDATMMKR--LEREIKVLKDKLAE-EERKNENQQKVEHLERQIKHDMHKIIC-----GHSLS 385

  Fly   239 LLGENPENITAALERSGQQLESEQLIDLEESIGKSP--------------------------LST 277
            ..|:.....|.....||..||..:....|:.|.:.|                          ::.
  Fly   386 DKGQQKRRRTWCPTASGSHLELAETGTTEDRIDQFPKVSHLPKPVFFHTSNAGKRWDNIPKTINI 450

  Fly   278 NGSSGVSDLQRLLKE-------------RDEQLKSV------------------TEKYEAVRKQE 311
            .||..:......:.|             |.:.||.:                  |:|.    |:|
  Fly   451 LGSLDIGTESNSISEEFLPAECIDFGSPRPDVLKPMLTIRQLPDLPLTPKGPLTTDKI----KKE 511

  Fly   312 EENVLLLAQTKQAIHTELELKDTEVRKLQEKLKQLESQRESHNNE----------VKEQFKKLQA 366
            .:::.:....::  |.|:|.:  ||:.|:|||.::.:||::...|          ::::...|:|
  Fly   512 IQDLQMFTSLEK--HFEVECE--EVQGLKEKLAEVTAQRDNLEQESLAEKERYDALEKEVTSLRA 572

  Fly   367 TKQEVDAKLMATEHLLNTLKESYAIKE---QQVVTLEAQLEA------IRV--------ENEQKV 414
            ..:..::|:...|..|:|||::..|.|   |..|.||.:.||      :||        |.|..:
  Fly   573 DNEAANSKISELEEKLSTLKQTMRIMEVENQVAVGLEFEFEAHKKSSKLRVDDLLSALLEKESTI 637

  Fly   415 KDLQKQNED------RNTQ--------------ASDS----SEQLKKLQAAVQDAESQLLSKDQL 455
            :.|||..::      ||::              |.||    .|:|:||   :.|.||:..|.:  
  Fly   638 ESLQKSLDNLTRDVLRNSKEGHMLSIAPEQEDIAGDSICNKCEELEKL---IADLESKKNSCE-- 697

  Fly   456 LESLRSEQAAKEQQLKHLK-----------------EQLGKLKQENENYLDKLRENKKSSDSQ-- 501
            .:.||.|..:...:|:.::                 |:|.|....::|...:|:|...:.|.|  
  Fly   698 CDQLRLEIVSVRDKLESVESAFNLASSEIIQKATDCERLSKELSTSQNAFGQLQERYDALDQQWQ 762

  Fly   502 ------------TNEAQDQQKKLQAAKDEAESKL-LATEELLHSLRNDYKAQEEKVALLEDKLK- 552
                        ....|::.:|||...::.||:. .|:......|:||....:..:|.|.::|: 
  Fly   763 AQQAGITTLHEKHEHVQEKYQKLQEEYEQLESRARSASSAEFQRLQNDNTKFQADIASLNERLEE 827

  Fly   553 -----TLSKENDVNVEKLHHINEQREAQSTDSQQKINELRAAKDEAEAKLLSTEHSLNALQAALS 612
                 |..:.::..||||...|.:..|:..:.:....|::...|....:|:.:....:||:..: 
  Fly   828 AQNMLTEVQNSESTVEKLRIQNHELTAKIKELETNFEEMQREYDCLSNQLMESVQENDALREEI- 891

  Fly   613 AKEEQAASLEQSL--NALKTESEHSLQDLRLHND--QLLEIVQR--HQQNDWEAQLARARE---- 667
             |:...:.:|:|:  :.:.::.:...||:.|.:.  ||.|.||:  .|.:...::|.||.:    
  Fly   892 -KQRPTSHVEESMRSSGISSDFDEQKQDINLLHQFVQLSESVQQIELQHHSGISRLFRANQMKLD 955

  Fly   668 ----------ELAAI--QSQRELHALE---LEKSLEMERESVAALNSEKASQEEQHRLK--LEQL 715
                      |.|..  :..|:..|.|   |:..|:..|..:..|:.|.....|:.||.  :.||
  Fly   956 QSEPGLKLCLESAEYIEEDNRQSDATEPICLKGFLKRHRFQIKRLSQEHVDMGEEKRLLDIISQL 1020

  Fly   716 QREIQILQDQHANSESETVAALKGQLEALSQDLATSQASLLAKEKELKASGNKLNKIKKQHEQHQ 780
            ::||:        .:|..:.|.:..:..:.:.:...:::||.|...:    ||:...::|.|..:
  Fly  1021 EQEIE--------EKSALMEATEATINEMREQMTNLESALLEKSVII----NKVEDYQRQIESLE 1073

  Fly   781 AKSSDQSARLEALQSELADRLSHSRQVESEKEELQARV--------------TGILEEIGTMQAQ 831
                .|:|.:..:..||.||::.    ||...|...||              :...:|:.|::..
  Fly  1074 ----KQNAEMTMVYEELQDRVTR----ESSMSESLLRVPPDEDTLPGCPTSPSRREQEVATLKTS 1130

  Fly   832 M----QQVQDSHSELEREKRKLESRIESLQQEQVDSSAQDER---TSAKLEEIQSENTKLAERNC 889
            :    .||.|..:|||...|:::.:..::.:.|.|.....||   ...:|.|: .|:||  ::..
  Fly  1131 ITELQSQVSDLKAELENHLRQIQLKDGNIARLQTDFEEMSERCLSMEVRLAEL-DEDTK--QKQE 1192

  Fly   890 LLEEQTNHLESQLQAKQDEIGKIQAKLQQVLDEHSKLQNAQELMD--HDHRTLQDKCDAYEKDKL 952
            ||:.|...|...|..    |.::|.|..|:::::.|...:..|.|  .|...|..:.|: :.:||
  Fly  1193 LLDRQAQKLSDDLCL----IDQLQKKNAQLVEQYHKATESLSLADAKPDQILLSSQYDS-QIEKL 1252

  Fly   953 LTKHTLDCLQSASEELHRVKANLDRELKEQDQQLSELRERQREQEQQLK-DQAERCAKLKAQNSE 1016
                 ...|.:|.:|||.|     |.:|  |.::|.||   .|...|:: ::.|..||..|:..|
  Fly  1253 -----NQLLNAAKDELHDV-----RRIK--DDEISALR---MEFLLQIETNEKENQAKFYAELQE 1302

  Fly  1017 SETQLQATISNLREQLDAYKQTEQGI----QEKLQATNSSYTTQIA------------------- 1058
            ::.:.::.::.|:|:|...::|...:    |.:|:|..|::...|:                   
  Fly  1303 TKDRYESNVAELKEKLLQVEETLSSVTVRCQAELEALKSAHKENISQAVEERNNLIVQHQAEMET 1367

  Fly  1059 ---TLEARWSAANSDVERLHEA-----NDALQLEMEQL------KIKHGQEREEVKESIAQ---- 1105
               ||:.:.:.|::...::.:|     |:.....||||      :.|...:.||||:::.|    
  Fly  1368 IRETLKNKLAEASTQQSKMEDAFRAEINEVRATLMEQLNQTKEDRDKGASKLEEVKKTLEQMING 1432

  Fly  1106 ---KNRQVVELQEAMATRD----RQLQEKIEASEKLAKFDEILIENEYLNK---------HTKQL 1154
               .:..:.||::..|.:|    :..::.||..::.:|..|.| :.|.|.:         |.|:|
  Fly  1433 GRVMSDTIAELEKTKAEQDLAVNKLTKDNIELEKQCSKTQEQL-QMESLTRDQISFEIEAHIKKL 1496

  Fly  1155 EAELAES-----------------------------AELK----------EKLKSLQCELYVLQE 1180
            |..:|.|                             :|::          |||:.||.|:.||..
  Fly  1497 ELIVASSKKRIIELEEKCDQQVLELDKCRLEKLSLESEIQKANSEHSCTMEKLQELQAEMKVLSN 1561

  Fly  1181 KAEQHAVQMAEKETQSATATAEVSELKKAIEEQA------VELTRQKEHASF----VTEQSDAVQ 1235
            :.|:   :..:.||:..|.|.::::|::.::|..      .:|..|.|....    ..|.|..:|
  Fly  1562 RNEK---EKCDFETKLETFTFKITDLEEVLKEAQHKVILYDDLVSQHERLKICLAEANELSSNLQ 1623

  Fly  1236 K-------DLLQAQQQLHDKQIELAMSRDE-QALLQAEADGLRQEVICLKEHLSPSTDSDSLRSL 1292
            |       :|:.:|:.:..:.:|:...|:| :|.:.|:|....:::..:.:          |:.:
  Fly  1624 KKVMSLHTELIDSQKGISSRDVEINELREELKAAMDAKATASAEQMTLVTQ----------LKDV 1678

  Fly  1293 NERLQRELEDLKHKSAGAE----------SNMQQEIEELQANNQQMAERINELETLRAGI-QAQQ 1346
            .||:..:.|....::|..:          ::||:..:.|::.|:::.|::...:.||..: :..:
  Fly  1679 EERMANQAEKFTREAANLKGSINELLLKLNSMQETKDMLESGNEELKEQLRNSQNLRNMLDEESK 1743

  Fly  1347 LLASMAPKNVQ--------EAAAAGEKAELESKLKEIMNEVQDVTNRNLFLEQKCENFLI-LEQS 1402
            :..|:..|.|:        |......|:|:..:..|:..||:...||...|.:|||.... ||.|
  Fly  1744 MCISLKEKLVKLEDAKTSLEQQLRDNKSEIYQRHTELTKEVELGRNRIGELTKKCEELCSDLENS 1808

  Fly  1403 NE-RLKLQNAK--LSRQLDETLVSMQHSEAVPANTEFEYLRNIMFQYLTGNTNNETLV-KVIS-- 1461
            :: ||.||..|  |.:.|:..|...|..:.|  ..|.|.||   |...:....||:.| ::||  
  Fly  1809 DQIRLDLQETKEQLKKTLENNLGWQQKVDEV--TRECEKLR---FDMQSKEVQNESKVQELISEC 1868

  Fly  1462 ----AVLKFSPQQAQVALEKEHQRRSLLNKL 1488
                :.||  .::|....|||...|::.:.|
  Fly  1869 EELRSTLK--SKEASFQSEKESMDRTISSLL 1897

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Golgin245NP_611787.2 Smc 286..1089 CDD:224117 217/1011 (21%)
Phage_GPO <306..421 CDD:301727 37/142 (26%)
Smc 737..1442 CDD:224117 188/866 (22%)
MIT_CorA-like <1244..>1333 CDD:294313 16/100 (16%)
Grip 1433..1477 CDD:197860 14/51 (27%)
cmetNP_524993.3 KISc 8..328 CDD:214526 11/64 (17%)
Motor_domain 8..321 CDD:277568 11/57 (19%)
Smc <680..1449 CDD:224117 178/819 (22%)
TMPIT 779..>867 CDD:285135 21/88 (24%)
Smc 1042..1910 CDD:224117 202/913 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126585
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.