DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Golgin245 and mud

Sequence 1:NP_611787.2 Gene:Golgin245 FlyBaseID:FBgn0034854 Length:1489 Species:Drosophila melanogaster
Sequence 2:NP_727769.3 Gene:mud FlyBaseID:FBgn0002873 Length:2567 Species:Drosophila melanogaster

Alignment Length:1809 Identity:369/1810 (20%)
Similarity:721/1810 (40%) Gaps:466/1810 (26%)


  Fly     2 FANLKNKLIEEVKASPSKF---------------QQFANAA----QAAVSSSSSTTPNSETNTSN 47
            |.|:.|||.|..:...:.|               |..||.|    |...:|.|...|:|..:...
  Fly   112 FHNICNKLPELTQTCIASFFRETVDRLLTREYLSQAIANVAVVYRQGVSTSVSPCLPSSSLSPDP 176

  Fly    48 NENFFSITEEDTP-QNSPYRIQKLPATSASALRGRSTQ-SLNG------ATSRTRKLSNSS---M 101
            .       .:|.| .::|......|::|...||....| .|||      :|.:|..|...:   .
  Fly   177 R-------SDDAPCPSTPSSSSSQPSSSTPQLRNHREQLRLNGCEMPPPSTPKTELLEQRTKELR 234

  Fly   102 ASDVSFRLPTYEAPAVYHLQSDLDETSSEFDDSASTARLDV-------ITKDQLYD--------- 150
            .......:..||...:...|.:.||.....:.....|::::       :|::. :|         
  Fly   235 GIRTQLEVVRYEKALLEEQQMEKDELIKVLNKEKMMAKMELEKLRNVKLTEEH-HDNESHHIMPY 298

  Fly   151 -------------AYKKSL-----DRYHKYRCRYTDLAKKY----KELERDSSKARSVLVETQDK 193
                         ..|:||     |:.|..|...::|::|.    |.|...:.:.|  .:|::..
  Fly   299 EFEHMKGCLLKEIGLKESLIAEITDKLHDLRVENSELSEKLNLAGKRLLEYTDRIR--FLESRVD 361

  Fly   194 ALRRISELREQ--CTLEQQAKAHLEEALRVEMDDMSCKMQAYQTKLQLL------GENPENI-TA 249
            .|.||...|:.  .:||.. |..|::.|:...||:..:::.......||      ...|||: ::
  Fly   362 DLTRIVSSRDVMISSLESD-KQELDKCLKEARDDLHNRIEVLNASSDLLDCSLSPNTTPENLASS 425

  Fly   250 ALERSGQQLESEQLIDLEESIGKSPLSTNGSSGVSDLQRLLKERDEQLKSVTEKY---------- 304
            .:::..::.|.|. .:|:|.:    |:.|.|.         :|..:.|.|..:|:          
  Fly   426 VIDKQLREKEHEN-AELKEKL----LNLNNSQ---------RELCQALSSFLQKHNIDHEFPVEW 476

  Fly   305 ------EAVRKQEEENVLLLAQTKQAIHTELELKDTEVRKLQEKLKQL----------------- 346
                  ..:...|.:.|..|.::.| :..|.:::...|.||.||.|.|                 
  Fly   477 TSSSLLSTISAIESKFVNTLEKSTQ-MKKECDVQSVCVEKLLEKCKLLSVSLGCQPKELDGFEAT 540

  Fly   347 ---------ESQRE----------------SHNNEVKEQFKKLQATKQEVDAKLMATEHLLNTLK 386
                     ||.||                |.||:::...::|.....|:.:.:...:..|..:.
  Fly   541 IPEAMESGFESSRECETILSCCHMKVVDIASKNNDLELDNERLNDKCAELKSIIDRGDQHLADIN 605

  Fly   387 ESYAIKEQQVVTLEAQLEAIRVENEQKVKDLQKQNEDRNTQASDSSEQLKK----LQAAVQDAES 447
            .....||:|:..:.|:::.:|..| ..::::..|..|:...|:..::.||:    |:|..:...:
  Fly   606 LQLIEKEKQIKDVGAEIQELRKRN-INLENMLSQIADKEASAASHAQHLKQCGELLRAKYEVCRN 669

  Fly   448 QLLSKD----------------------------------------QLLESLRSEQAAKEQQLKH 472
            :|::|:                                        |:|:.| :|.:||...:.|
  Fly   670 ELIAKNAAQDELVRMMMVPDGETLNGRVRQLIDLEMMHDEHNKMYAQMLKQL-NELSAKHDNMTH 733

  Fly   473 LKEQLGKLKQ----------------ENENYLDKL----------RENKKSS--DSQTN--EAQD 507
              ..|..:|:                |:.|:.|:.          |...||:  .|.||  |:..
  Fly   734 --SHLDFVKRTEIELETKNAQIMAFDEHNNHFDRFLTRIFTLLRSRNCPKSTTMGSATNFLESMH 796

  Fly   508 QQKKLQAAKDEAESKLLATEELLHSLRNDYKAQEEKVALLEDKLKTLSKEN------DVNVEKLH 566
            .:|:.:..:...|.:||:.::|...| :|.:::.|::|  :..:..:.|.|      :||.||:.
  Fly   797 IEKRFENIEMLIEGQLLSADDLKREL-DDLRSKNEELA--KQNINGIIKRNKFITSLEVNTEKVK 858

  Fly   567 HINEQREAQSTDSQQKINELRAAKDEAEAKLLSTEHSLNALQAALSAKEEQAASLEQSLNALKTE 631
            ......|.::...:||:.:                     |:..||.::..|..:.|.|:..:.|
  Fly   859 QYITDLEEEAFKRKQKVVQ---------------------LENTLSKEQSNAKEMAQRLDIAQQE 902

  Fly   632 SEHSLQDLRLHNDQLLEIVQRHQQNDWEA-----QLARAREELAAIQSQRELHALELEKSLEMER 691
                ::|..:...:.:..::...|.|:..     ||.....|...:..|.|:...|....:|...
  Fly   903 ----IKDYHVEAIRFINTIRDRLQQDFNGVNTPQQLGTCMTEFLKMYDQMEVRYEESSSLVEKLT 963

  Fly   692 ESVAALNSEKASQE--------EQHR-LKLEQLQREIQILQDQHA-----NSESETV------AA 736
            ||.|.|..:.|..:        .||. ..::||...||.|:..:|     |:.|.||      :.
  Fly   964 ESQAKLEMQVAELQVELENKDTNQHSGALIKQLNDTIQNLEKVNAKLSEDNTVSHTVHSKLNESL 1028

  Fly   737 LKGQ------------LEALSQDLATSQASLLAKEKELKASGNKLNKIKKQHEQHQAKSSDQSAR 789
            ||.|            |||..::|:.....|...:.:||:|..|:.:||:.:|: |.|:......
  Fly  1029 LKAQKELDLRAKIIENLEASERNLSMKLCELKDLKNKLKSSDEKIAQIKETYEE-QIKALQAKCD 1092

  Fly   790 LEALQSELADRLSHSRQVESEKEELQ--ARVTGILEEIGTMQAQMQQVQDSHS-ELEREKRKL-- 849
            :||.::|..:|..:....:.:::.|:  ..::..|||:.....:.||:.||.. ||:..:::|  
  Fly  1093 MEAKKNEHLERNQNQSLTQLKEDALENCVLMSTKLEELQAKLQEGQQLVDSQKLELDMNRKELAL 1157

  Fly   850 -ESRIESLQQEQVDSSAQDERTSAKLE----EIQSENTKLAERNCLLEEQT---NHLESQLQAKQ 906
             :|..|:..:...|...|.|.....::    |::.|..:||..|..:..||   :.||.|.::.|
  Fly  1158 VKSAYEAQTKLSDDLQRQKESGQQLVDNLKVELEKERKELAHVNSAIGAQTKLSDDLECQKESGQ 1222

  Fly   907 DEIGKIQAKLQQ----------VLDEHSKL--------QNAQELMDH-------DHRTLQDKCDA 946
            ..:..::.:|::          |::..:||        ::||:|:|:       :.:.|.....|
  Fly  1223 QLVDNLKVELEKERKELAQVKSVIEAQTKLSDDLQREKESAQQLVDNLKVELDKERKELAQVNSA 1287

  Fly   947 YEKDKLLTKHTLDCLQSASEELHRVKANLDRELKEQDQ---------QLSELRERQREQEQQLKD 1002
            :|....|:.......:||.:.:..:|..||:|.||..|         :||:..:|::|..|||.|
  Fly  1288 FEAQTKLSDDLQRQKESAQQLVDNLKVELDKERKELAQVNSAFEAQTKLSDDLQREKESAQQLVD 1352

  Fly  1003 --------QAERCAKLKAQNSESETQL-----------QATISNLREQLDAYK----------QT 1038
                    :.:..|::|:. .|::|:|           |..:.||:.:||..:          :.
  Fly  1353 NLKVELDKERKELAQVKSV-IEAQTKLSDDLQRQKESAQQLVDNLKVELDKERKELAKVKSVIEA 1416

  Fly  1039 EQGIQEKLQATNSSYTTQIATLEARWSAANSDVERLHEANDALQLEMEQLKIKHGQEREEVKESI 1103
            :..:.:.||....|    ...|||: :..:.|::|..|:  |.|| ::.||::..:||:|:    
  Fly  1417 QTKLSDDLQRQKES----AQQLEAQ-TKLSDDLQRQKES--AQQL-VDNLKVELDKERKEL---- 1469

  Fly  1104 AQKNRQVVELQEAMATRDRQLQEKIEASEKLAKFDEILIENEYLNKHTKQLEAELAESAELKEKL 1168
                .||..:.||.......||.:.|::::|.  |.:.:|.:...|...|:::.:....:|.:  
  Fly  1470 ----AQVKSVIEAQTKLSDDLQRQKESAQQLV--DNLKMELDKERKELAQVKSAIGAQTKLSD-- 1526

  Fly  1169 KSLQCELYVLQEKAEQHAVQMAEKETQSATATAEVSELKKAIEEQ---AVELTRQKEHASFVTEQ 1230
             .|:|:...:|:..:...|:: |||.:      |::::..|.|.|   :.:|..|||.|      
  Fly  1527 -DLECQKESVQQLVDNLKVEL-EKERK------ELAKVNSAFEAQTKLSDDLKLQKEDA------ 1577

  Fly  1231 SDAVQKDLLQAQQQL----HDKQIELAMSRDEQALLQAEADGLRQEVICLKEHLSP----STDSD 1287
                |:::...:::|    .:.:::||...|....|:.....:.:|.....|.::.    ..:.|
  Fly  1578 ----QREVFLVKERLVKEKREFEVKLATLEDIIETLEMRCTQMEEERATAYEQINKLENRCQEKD 1638

  Fly  1288 SLRSLNERLQRE---LEDLKHKSAGAESNMQQEIEELQANNQQMAERINELETLRAGI------- 1342
            :::|  .:||.|   :|.|.|:.....:.....:|:|   |:::||::::|:.:::.:       
  Fly  1639 NVKS--SQLQVETFKVECLHHQLKSEMATHNSLVEDL---NRKLAEKVSKLDFVQSRLMTEIAEH 1698

  Fly  1343 -QAQQLLASMA--PKNVQ-----EAAAAGEKAELESKLKEIMNEVQDVTNR--NLFLEQKCENFL 1397
             |.:..||.:.  ||.|:     ||..| |:.|.::||..:...:.::|..  |..||...: .|
  Fly  1699 NQVKDQLAQITDIPKVVELQHRLEAETA-EREEAQNKLAVVTGRLDEITRELDNARLEHGAQ-IL 1761

  Fly  1398 ILEQSNERLKLQNAKLSRQLD--ETLVSMQHSEAVPANTEFEYLRNIMFQYLTG 1449
            .:|::...:..:||:|...::  ...|.......:.:|.|.|.|.:|......|
  Fly  1762 RMEETAREVGNKNAELCELIEFYRNRVEALERLLLASNQELEELNSIQSNQAEG 1815

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Golgin245NP_611787.2 Smc 286..1089 CDD:224117 212/1054 (20%)
Phage_GPO <306..421 CDD:301727 29/157 (18%)
Smc 737..1442 CDD:224117 182/826 (22%)
MIT_CorA-like <1244..>1333 CDD:294313 20/100 (20%)
Grip 1433..1477 CDD:197860 6/18 (33%)
mudNP_727769.3 SMC_prok_B 319..1178 CDD:274008 181/910 (20%)
SCP-1 853..1571 CDD:114219 169/773 (22%)
Smc 1234..>1944 CDD:224117 135/629 (21%)
DUF948 1392..1517 CDD:295114 33/143 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126585
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.