DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Golgin245 and AT4G38062

Sequence 1:NP_611787.2 Gene:Golgin245 FlyBaseID:FBgn0034854 Length:1489 Species:Drosophila melanogaster
Sequence 2:NP_001328886.1 Gene:AT4G38062 AraportID:AT4G38062 Length:1050 Species:Arabidopsis thaliana

Alignment Length:1282 Identity:264/1283 (21%)
Similarity:539/1283 (42%) Gaps:300/1283 (23%)


  Fly   210 QAKAHLEEALRVEMDDMSCKMQAYQTKLQLLGENPENITAALERSGQQLESEQLIDLEESIGKSP 274
            :.|| :.|.||::          |:.|.:||    ||:        :::::||||::.|:     
plant    10 EVKA-VNEKLRID----------YRNKTELL----ENL--------KKVQNEQLIEIREA----- 46

  Fly   275 LSTNGSSGVSDLQRLLKERDEQLKSVTEKYEAVRKQEEENVLLLAQTKQAIHTELEL----KDTE 335
                         ||:.|:        ..:|...|..|     :|:.|:| :.||:.    ||:.
plant    47 -------------RLVNEK--------HGFEIEEKSRE-----IAELKRA-NEELQRCLREKDSV 84

  Fly   336 VRKLQEKLKQLESQRESHNNEVKEQFKKLQATKQEVDAKLMATEHLLNTLKESYAIKEQQVVTLE 400
            |:::.:...:|.:..|....|.:|:.:.:.:...|...|.:..|...|.    |..:.:.:..|.
plant    85 VKRVNDVNDKLRANGEDKYREFEEEKRNMMSGLDEASEKNIDLEQKNNV----YRAEIEGLKGLL 145

  Fly   401 AQLEAIRVENEQKVKDLQKQNEDRNTQASDSSEQLKKLQAAVQDAESQLLSKDQLLESLRSEQAA 465
            |..|..|:|.|:.||.: |:...|:.......|:                 |.|:.|.|:    .
plant   146 AVAETKRIEAEKTVKGM-KEMRGRDDVVVKMEEE-----------------KSQVEEKLK----W 188

  Fly   466 KEQQLKHLKEQLGKLK-----------QENENYLDKLRENKKSSDSQTNEAQDQQKKLQ-----A 514
            |::|.|||:|...|||           :|....||::...:...||.|..::|.|||||     .
plant   189 KKEQFKHLEEAYEKLKNLFKDSKKEWEEEKSKLLDEIYSLQTKLDSVTRISEDLQKKLQMCNGAL 253

  Fly   515 AKDEAESKLLATEELLHSLRNDYKAQ-EEKVALLED---KLKTLSKENDVNVEKLHHINEQREAQ 575
            .::|...|.|..:.      :::||: |:..|..:|   :|..|:.:.|..|.:|......::|.
plant   254 TQEETRRKHLEIQV------SEFKAKYEDAFAECQDARTQLDDLAGKRDWEVAELRQTLSMKDAY 312

  Fly   576 STDSQQKINELRAAKDEAEAKLLSTEHSLNALQAALSAKEEQAASLEQSLNALKTESEHSLQDL- 639
            ..:.:.:..:|    ::...:||.            |.||.|.|:::.|.|:..::.::..::| 
plant   313 FKEMKYENGKL----EQENRELLG------------SLKELQEATIQGSGNSALSKLKNKFRNLE 361

  Fly   640 RLHNDQLLEIVQRHQQNDWEAQLARAREEL--AAIQSQRELHALELEKSLEMERESVAALNSEKA 702
            .:|.:....:  |.::.:|.:|:.:..||:  ..:|.|.:..||   |.:|:|.|:..:..::..
plant   362 NIHKNCSANL--RSKEAEWSSQVEKMVEEINDYKLQLQSKEAAL---KEVELELENCRSSTAKMR 421

  Fly   703 SQEEQHRLKLEQLQREIQILQDQHANSESETVAALKGQ---LEALSQDLATSQASLLAKEKELKA 764
            .|.|:..:....|.|.:...|.:.||::.:.:...|.:   ...|.:.|....|:|...:.|:|.
plant   422 LQYEEISIMFLVLSRTVSEAQSRLANAKDKQIKDEKREGNCYSLLMEQLDQKNAALAKAQMEIKE 486

  Fly   765 SGNKLNKIKKQHEQHQAKSSDQSARLEALQSELADRLSHSRQVESEKEELQARVTGILEEIGTMQ 829
            ....:..:.|              |:|.|.......:...::||..||        ::||....|
plant   487 ERESVACLLK--------------RIEMLDLFENQNIQMQKEVERFKE--------MVEESSRFQ 529

  Fly   830 AQMQQ-VQDSHSELEREKRKLESRIESLQQEQVDSSAQDERTSAKLEEIQSENTKLAERNCLLEE 893
            .|||: ::::.::.|   .||....::|....:|..|:.|:..:...:|:|..| :.|:|.::|:
plant   530 TQMQEKMKEAENDYE---EKLLQVCDALDNTNIDLVAEREKVVSLTRQIESLGT-VKEKNLVMEK 590

  Fly   894 QTNHLESQLQAKQDEIGKIQAKLQQVLDEH-SKLQNAQELMDHDHRTLQDKCD-AYEKDKLLTKH 956
            :|...:..|:..:        |.:.:|:|. |:|::..   :.:.|.|..|.| ||.|       
plant   591 ETQEYKEMLEESE--------KCRVLLEEQISQLESDS---NENIRELCSKVDIAYAK------- 637

  Fly   957 TLDCLQSASEELHRVKANLDRELKEQDQQLSELRERQREQEQQLKDQAERCAKLKAQNSESETQL 1021
                   .:||:.:. |:|.|:.:..|     |.|..|::|                        
plant   638 -------LAEEVEKT-ASLVRKSESID-----LNEEHRQRE------------------------ 665

  Fly  1022 QATISNLREQLDAYKQTEQGIQEKLQATNSSYTTQIATLEARWSAANSDVERLHEANDALQLEME 1086
               :.:.:|.|:...:|:..:|||:....:....::|.:......|||::.  .:.::..|:|.:
plant   666 ---LDHYKEMLEESTKTQLLLQEKVVDVENDSKRKLADVSEALEIANSELS--DKTSEVFQIEFQ 725

  Fly  1087 QLKIKHGQEREEVKESIAQKNRQVVELQEAMATRDRQLQEKIEAS--EKLAKFDEILIE-NEYLN 1148
            ..          |.:|||::.:..:|       :::.|::::|||  |::...:.|..| ||.::
plant   726 LW----------VWKSIAKRLKAELE-------QNQNLRKRVEASLLEQVGVGEAIKQEKNELVH 773

  Fly  1149 K-----HTKQLEAELAES--AELKEKLKSLQCELYVLQEKAEQHAVQ-------MAEKETQSATA 1199
            |     |.:..::|..||  .:..|.|:|||.|:.:|::.:.:..::       :.|:|.|:...
plant   774 KLKVISHARSSDSEKKESLMRDKDEMLESLQREVELLEQDSLRRELEDVVLAHMIGERELQNERE 838

  Fly  1200 TAEVSELKKAIEEQAVELTRQKEHASFVTEQSDAVQKDLLQAQQQLHDKQIELAMSRDEQALLQA 1264
            ...:.:..:.:.|...||....:..|.:.:|.......|.:..::|..:||..|:..:.:.::..
plant   839 ICALQQKDQDLCEVKHELEGSLKSVSLLLQQKQNEVNMLRKTWEKLTARQILTAVETESKKMMII 903

  Fly  1265 EADGLRQEVICLKEHLSPSTDSDS-LRSLNERLQRELEDLKHKSAGAESNMQQEIEELQANNQQM 1328
            |.:|   |:..|.:.|..|.:|.| .|....:.:.|||..:.:.....:.||:::...:|...::
plant   904 ELEG---EISSLSQKLETSNESVSCFRQEATKSRAELETKQTELKEVTTQMQEKLRTSEAEKTEL 965

  Fly  1329 AERINELETLRAGIQAQQLLASMAPKNVQEAAAAGEKAELESKL-------KEIMNEVQDVTNRN 1386
            .:.:..|.|     :.:.||:.:              :|:|..:       .::|..::.||   
plant   966 VKEVASLST-----EKRNLLSFI--------------SEMEDGMLKLYDGDTKLMKTLERVT--- 1008

  Fly  1387 LFLEQKCENFLILEQSNERLKLQNAKLSRQLDETLVSMQHSEAVPAN 1433
                |.|:.|  .:::|....:.:.:|:.:.:|.:|:...|...|.|
plant  1009 ----QCCDGF--GKENNNGETIGSPRLAMKHEEDVVTEDRSPFRPLN 1049

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Golgin245NP_611787.2 Smc 286..1089 CDD:224117 175/836 (21%)
Phage_GPO <306..421 CDD:301727 28/119 (24%)
Smc 737..1442 CDD:224117 143/729 (20%)
MIT_CorA-like <1244..>1333 CDD:294313 19/90 (21%)
Grip 1433..1477 CDD:197860 1/2 (50%)
AT4G38062NP_001328886.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.