DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Golgin245 and spo15

Sequence 1:NP_611787.2 Gene:Golgin245 FlyBaseID:FBgn0034854 Length:1489 Species:Drosophila melanogaster
Sequence 2:NP_593009.1 Gene:spo15 PomBaseID:SPAC1F3.06c Length:1957 Species:Schizosaccharomyces pombe

Alignment Length:1796 Identity:378/1797 (21%)
Similarity:684/1797 (38%) Gaps:509/1797 (28%)


  Fly    29 AAVSSSSSTTPNSETNTS----------------NNENFFSITEEDTPQNSPYRIQ-KLPA---- 72
            :..||:...||.|.:|.|                |     |:|::....|...::: ||.|    
pombe    93 STASSALPLTPRSPSNASWLLVRGGLLDSPILDIN-----SVTQKSNLLNELKQVRSKLAALEHE 152

  Fly    73 -------TSASALRGRSTQSLNGATSRTRKLSNSSMASDVSFRLPTYEAPAVYHLQSDLDETSSE 130
                   .|:|..:.::|.|:...||.          .|||:            .|..|....|.
pombe   153 NGILSLQLSSSNKKDKNTSSVTTLTSE----------EDVSY------------FQKKLTNMESN 195

  Fly   131 FDDSASTARLDVITKDQLYDAYKKSLDRYHKYRCRYTDLAKK---YKELERDSSKARSVLVETQ- 191
            |....|.|          ||..::.|....|       |.||   |::::.|.|..::.|.|.| 
pombe   196 FSAKQSEA----------YDLSRQLLTVTEK-------LDKKEKDYEKIKEDVSSIKASLAEEQA 243

  Fly   192 -DKALRRISELREQ---------CTLEQQAKAHLEEALRVEMDDMSCKMQAYQTKLQLLGENPEN 246
             :|:||...|..|:         .||.|     .|.:||.|     ||  ..|.||:....|.| 
pombe   244 SNKSLRGEQERLEKLLVSSNKTVSTLRQ-----TENSLRAE-----CK--TLQEKLEKCAINEE- 295

  Fly   247 ITAALERSGQQLESEQLIDLEESIG--------KSPLSTNGSSGVSDLQRLLKERDEQLKSVTEK 303
                        :|:.|.:|:.::.        |..|..:.|:.:|:...|..||| .|....||
pombe   296 ------------DSKLLEELKHNVANYSDAIVHKDKLIEDLSTRISEFDNLKSERD-TLSIKNEK 347

  Fly   304 YEAV--------------RKQEEENVLLLAQTKQAIHTELELKDTEVRKLQEKLKQLESQRESHN 354
            .|.:              ..|.||.::.|.::.:.||::|...::::...:::.|.|:...:.:.
pombe   348 LEKLLRNTIGSLKDSRTSNSQLEEEMVELKESNRTIHSQLTDAESKLSSFEQENKSLKGSIDEYQ 412

  Fly   355 NEVKEQFKKLQATKQEVDAKLMATEHLLNTLKESYAIKEQQVVTLEAQLEAIRVENEQKVKDLQK 419
            |.:..:.|.::....:::....:..|....|               |::.:.|....:|:||.:|
pombe   413 NNLSSKDKMVKQVSSQLEEARSSLAHATGKL---------------AEINSERDFQNKKIKDFEK 462

  Fly   420 QNEDRNTQASDSSEQLKKLQAAVQDAESQLLSKDQLLESLRSEQAAKEQ---------------- 468
            ..:|.....:.||.:||:..|.:.       .|||.|.:||.:  .|||                
pombe   463 IEQDLRACLNSSSNELKEKSALID-------KKDQELNNLREQ--IKEQKKVSESTQSSLQSLQR 518

  Fly   469 -----QLKH------LKEQLGKLKQENEN------YLDKLRENKKSSDSQTNEAQDQQKKLQAAK 516
                 :.||      |.|..|:|:.|..|      .|..|...|:::.:..||..:.:..||...
pombe   519 DILNEKKKHEVYESQLNELKGELQTEISNSEHLSSQLSTLAAEKEAAVATNNELSESKNSLQTLC 583

  Fly   517 DEAESKLLAT-------EELLHSLRNDYKAQEEKVALLEDKLKTLSKENDVNVEKLHHINEQREA 574
            :..:.||..:       |:...||...:|...|....||:..:|::|:......||    :|.:.
pombe   584 NAFQEKLAKSVMQLKENEQNFSSLDTSFKKLNESHQELENNHQTITKQLKDTSSKL----QQLQL 644

  Fly   575 QSTDSQQKINELRAAKDEAEAKLLSTEHSLNALQAALSAKEEQAASLEQSLNALKTE---SEHSL 636
            :..:.:||.:.|....::...|||..|.|    ..:|..|:|...|||:::..||.:   ||.:|
pombe   645 ERANFEQKESTLSDENNDLRTKLLKLEES----NKSLIKKQEDVDSLEKNIQTLKEDLRKSEEAL 705

  Fly   637 QDLRLHNDQLLEIVQ----RH-----QQNDWEAQLARAREELAAIQSQRELHALELEKSLE---- 688
            :..:|....|.|::.    :|     |:||..:.|:.|:...|.:.|       ||.||.|    
pombe   706 RFSKLEAKNLREVIDNLKGKHETLEAQRNDLHSSLSDAKNTNAILSS-------ELTKSSEDVKR 763

  Fly   689 --------------MERESVAALNSEKASQEEQHRLK-----------------------LEQLQ 716
                          |::...:.:||.::.....|.|:                       .|.|.
pombe   764 LTANVETLTQDSKAMKQSFTSLVNSYQSISNLYHELRDDHVNMQSQNNTLLESESKLKTDCENLT 828

  Fly   717 RE-------IQILQDQHANSESETVAALKGQLEALSQDLATSQASL------------------- 755
            ::       :|.|..:|.|.||: |:.||.....||.||...::||                   
pombe   829 QQNMTLIDNVQKLMHKHVNQESK-VSELKEVNGKLSLDLKNLRSSLNVAISDNDQILTQLAELSK 892

  Fly   756 ------------------LAKEKELKASGN-----KLNKIKKQHEQHQAKSSDQSARLEALQSEL 797
                              |..||:|..:.|     :|:|:..:.:..::||||...:|.|.|.|:
pombe   893 NYDSLEQESAQLNSGLKSLEAEKQLLHTENEELHIRLDKLTGKLKIEESKSSDLGKKLTARQEEI 957

  Fly   798 A----DRLSHSRQVESEKEELQARVTGILEEIGTMQAQMQQVQDSHSELEREKRKL--------- 849
            :    :.:|.|:.:.|.|.:|..    .|.:...::|.::.:::..||:|.|:..|         
pombe   958 SNLKEENMSQSQAITSVKSKLDE----TLSKSSKLEADIEHLKNKVSEVEVERNALLASNERLMD 1018

  Fly   850 -----ESRIESLQQEQVDSSAQDERTSAKLEEIQSENTKL----AERNCLLEEQTN---HLESQL 902
                 ...|.|||.|.....|:::...:||..:.||...|    ::.|..||::||   ::|..:
pombe  1019 DLKNNGENIASLQTEIEKKRAENDDLQSKLSVVSSEYENLLLISSQTNKSLEDKTNQLKYIEKNV 1083

  Fly   903 QAKQDEIGKIQAKLQQVLDEHSKL--QNAQELMDHDHRTLQDKCDAYEKDKLLTKHTLDCLQSAS 965
            |...||..:...:|:::..::.||  :|||                 .||:||      .|:..|
pombe  1084 QKLLDEKDQRNVELEELTSKYGKLGEENAQ-----------------IKDELL------ALRKKS 1125

  Fly   966 EELHRVKANLDRELKEQDQQLSELRERQRE----QEQ----------QLKDQAERCAKLKAQNSE 1016
            ::.|.:.||...:|||:...|.:|...:.|    .||          :..|.|.|.:.:|...|:
pombe  1126 KKQHDLCANFVDDLKEKSDALEQLTNEKNELIVSLEQSNSNNEALVEERSDLANRLSDMKKSLSD 1190

  Fly  1017 SETQLQATISNL---REQLDAYK--------------QTEQGIQEKLQATNSSYTTQIATLEARW 1064
            |:..:....|:|   .::||..|              |....:.:.|:....|:.....:|....
pombe  1191 SDNVISVIRSDLVRVNDELDTLKKDKDSLSTQYSEVCQDRDDLLDSLKGCEESFNKYAVSLRELC 1255

  Fly  1065 SAANSDVERLHEANDALQL------EMEQLKIKHGQEREEVKESIAQKNRQVVELQEAMATRDRQ 1123
            :.:..||......:|....      |:.:|.:   ...|...::..|.|.:.:||...:.|.|.:
pombe  1256 TKSEIDVPVSEILDDNFVFNAGNFSELSRLTV---LSLENYLDAFNQVNFKKMELDNRLTTTDAE 1317

  Fly  1124 LQEKIEASEKLA-KFDEILIENEYLNKHTKQLEAE-LAESAELKEKLKSLQCELYVLQEKAEQHA 1186
            ..:.:...|||. :.|:.||:...|.|..|..|.. |.:.||:.|.:.|       |:|..|:..
pombe  1318 FTKVVADLEKLQHEHDDWLIQRGDLEKALKDSEKNFLRKEAEMTENIHS-------LEEGKEETK 1375

  Fly  1187 VQMAEKETQSATATAEVSELKKAIE-----------------------EQAVELTRQKEHASF-- 1226
            .::||..::........::||..::                       |:::...||||.:..  
pombe  1376 KEIAELSSRLEDNQLATNKLKNQLDHLNQEIRLKEDVLKEKESLIISLEESLSNQRQKESSLLDA 1440

  Fly  1227 ----------VTEQSDAVQKDLLQAQQQLHDKQIELAMSRDEQALLQAEADGLRQEVICLKEHLS 1281
                      .:.::.::.:.:......|.||..|||.:.::...||.    |..|.:.|.|:: 
pombe  1441 KNELEHMLDDTSRKNSSLMEKIESINSSLDDKSFELASAVEKLGALQK----LHSESLSLMENI- 1500

  Fly  1282 PSTDSDSLRSLNERLQRE---LEDLKHKSAGAESNMQQEIEELQANNQQMAERINELETLRAG-- 1341
                ...|:...|::|.:   :::|.|:...:::|.:.::.:..:..:.::|.|.:|..|.|.  
pombe  1501 ----KSQLQEAKEKIQVDESTIQELDHEITASKNNYEGKLNDKDSIIRDLSENIEQLNNLLAEEK 1561

  Fly  1342 --------------IQAQQLLASMA-PKNVQEAAAAGEKAELESKLKEIM---NEVQDVTNRNLF 1388
                          :|....||.:. .|:..|:.....|.:|.|..:|:.   ||...:|.|.|.
pombe  1562 SAVKRLSTEKESEILQFNSRLADLEYHKSQVESELGRSKLKLASTTEELQLAENERLSLTTRMLD 1626

  Fly  1389 LEQKCENFLILEQSNERLKLQNAKLSRQLDETLVSMQHSEAVPANTEFEYLRNIMFQYLTGNTNN 1453
            |:.:.::...::.|..    ::.:..|.|::::.|:|....:.:|| .|.|::::......|...
pombe  1627 LQNQVKDLSNIKDSLS----EDLRTLRSLEDSVASLQKECKIKSNT-VESLQDVLTSVQARNAEL 1686

  Fly  1454 ETLV-----KV---------ISAVLKFSPQQAQVALEKEHQ 1480
            |..|     |:         :|..||....|    ||::|:
pombe  1687 EDEVSRSVDKIRRRDDRCEHLSGKLKKLHSQ----LEEQHE 1723

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Golgin245NP_611787.2 Smc 286..1089 CDD:224117 218/1023 (21%)
Phage_GPO <306..421 CDD:301727 19/129 (15%)
Smc 737..1442 CDD:224117 179/871 (21%)
MIT_CorA-like <1244..>1333 CDD:294313 20/92 (22%)
Grip 1433..1477 CDD:197860 14/58 (24%)
spo15NP_593009.1 PRK03918 <176..723 CDD:235175 143/644 (22%)
SMC_prok_B 455..1236 CDD:274008 187/833 (22%)
Mplasa_alph_rch 881..1539 CDD:275316 142/704 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126585
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.